KEGG   Chelativorans sp. BNC1: Meso_1414Help
Entry
Meso_1414         CDS       T00374                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Meso_1414
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Meso_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1512775..1513326
Genome map
AA seq 183 aa AA seqDB search
MTGPNRKARAFLCLGGNLGEPERAMAEALQVLDASPETCVIRVSSVYRTPPWGKLDQPEF
LNAAAEIETGLTPHELLSQCLAIERMLKRERRDRWGPRVIDIDILTYDDERIADAMLEIP
HPRMLQRAFVLLPLAEIAPGLVLEGKSISEHMARLDASGVEPVKTGGEWWKNEAIRPLTR
SPS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgactggccccaataggaaagcacgcgcctttttgtgcctgggcggcaatctgggcgag
ccggaacgcgccatggcagaggcgctgcaggttcttgatgccagccccgagacctgcgtc
atccgtgtttcttcggtctatcgaacgccgccctggggcaagctggatcagccggagttt
ctcaacgcggccgccgaaattgagaccgggcttaccccgcacgaactgctttcgcagtgt
ctggcaatcgagcgcatgctgaaaagggagcgccgcgaccggtggggcccacgcgtcatc
gatatcgacatcttgacctatgatgatgagcggattgccgacgccatgcttgaaattccg
cacccgcggatgctccagcgcgctttcgtgctgctgccactggccgaaatcgcgcctggc
cttgtgctcgaaggaaagtcgatcagtgaacatatggcacggctcgatgcttccggcgtc
gagccggtcaagaccggcggcgagtggtggaagaatgaggctattcgcccgttaacgcgc
tcaccgtcttag

DBGET integrated database retrieval system