KEGG   Chelativorans sp. BNC1: Meso_1568Help
Entry
Meso_1568         CDS       T00374                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mes  Chelativorans sp. BNC1
Brite
Enzymes [BR:mes01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Meso_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1686754..1687428
Genome map
AA seq 224 aa AA seqDB search
MNADFSVQRETMIEGQLRTQDVTNVPLIQAMREIPREAFVPSRRKTLAYMDEDLEISPAS
GGNPPRYLMEPARFGKLVQLAEVRSSDLVLDVGCATGYSAAVLSKIASFVVALECDSALA
ETASSLLTELGCMNTTVVTGALNEGYVNESPYDVIFIGGGVDYVPDSLLAQLAEGGRLVA
VIGRGNAARAHLFLKEGGLLSSRADFNAAVKPLPGFEIEKGFVF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgatttttcagtgcagcgcgagaccatgatcgaggggcagctgcgcactcag
gatgtaacgaatgtgcctctgatccaggccatgcgtgagattcctcgcgaagcatttgtg
ccgagccgccgcaagacacttgcctatatggatgaggacctggaaatttccccggcatcc
ggaggaaatccgccgcgctacctcatggaacccgcccgcttcggcaaattggtacagcta
gcggaggtgcgatcgagcgaccttgtgctcgatgtcggatgtgcgaccggctattccgca
gcggttttgtccaagatcgcaagcttcgtggtcgcgctggagtgcgattctgctcttgcg
gaaacggcgtcctcgttgctcaccgagctcggttgcatgaacactaccgtcgttaccggg
gcgctgaacgagggttacgtgaatgaatccccttatgatgtaattttcatcgggggcggc
gtggattatgttcctgattcgttacttgctcagttggccgaaggagggcgcctggttgcg
gtgatcggaagggggaatgcggcaagagcccatctcttcctgaaggaaggaggcttgctg
tcgtcgcgcgccgacttcaatgctgccgtgaagcccttgccgggcttcgagatcgaaaaa
ggattcgtattttaa

DBGET integrated database retrieval system