KEGG   Chelativorans sp. BNC1: Meso_1598Help
Entry
Meso_1598         CDS       T00374                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Meso_1598
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Meso_1598
Exosome [BR:mes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Meso_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1720848..1722350
Genome map
AA seq 500 aa AA seqDB search
MTGYILAIDQGTTSSRAVIFDGAMKIVAVGQKEFPQHYPASGWVEHDPEDIWKSVVATVK
TALRKAKLEASRITAIGITNQRETAVIWDRATGMPIHNAIVWQDRRTAPLCAKLKKAGLE
PKFTRKTGLLLDPYFSGTKFAWLLDNVKGARRRAEKGELLAGTIDTYLIWRLTGGRMHAT
DATNASRTLLYNISKNAWDADLLKILRIPTALLPEVKDCAAEFGVTEKKIFGAEIPILGV
AGDQQAATIGQACFEPGMLKSTYGTGCFAVLNTGERLIRSKNRLLSTIAYRLDGKTTYAL
EGSIFIAGAAVQWLRDGIKVIGKAAESGALAERSDETQQIYLVPAFVGLGAPHWDADARG
AIFGLTRNSGPAEFARAALESVAYQTHDLLVAMKRDCGNTFGKTVLRVDGGMVASSWTMQ
CLADILDAPVDSPTITETTALGAAWLAGSKAGIWPDRATFAKSWALERRFEPQMDGRQRK
AKLAGWADAVSRTLTARAPC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacagggtacattttggcgattgaccagggcacgacatcgagccgggccgtcatcttc
gacggcgcgatgaagatcgtggcggtgggccagaaggaatttccgcagcactaccccgcc
tccggctgggtcgagcacgacccagaggacatctggaagagcgtcgtggcgacggtgaag
acggcgctcaggaaagcgaagctggaggcctcccggatcaccgcgatcggcatcaccaac
cagcgcgaaacggcggtaatctgggatagggcgaccggcatgcccattcacaacgccatc
gtctggcaggaccgccgcaccgcccccctctgcgcgaagctcaagaaggccgggctggag
ccgaaattcacccgcaagacagggttgctgctcgatccttatttttccggcaccaaattt
gcctggctgctggacaatgtcaaaggcgcgcgccggcgcgctgagaagggcgagcttctg
gccggcacgatcgacacgtatctcatttggcggctgacgggcggcaggatgcacgcaacc
gacgcgactaacgcctcgcgcacgctgctctacaacatttcgaagaatgcctgggacgcc
gaccttctgaagatcctgcgcattccgacagcccttttgccggaagtgaaggactgcgcg
gcggagttcggggtgacggagaagaagatattcggcgccgagatcccgatccttggagtg
gccggcgaccagcaggcggccaccatcgggcaggcctgcttcgagcctggcatgctgaaa
tccacttacggcaccggttgcttcgccgtgcttaacacgggcgaaaggctcatccgctcc
aagaacaggctgctttccaccatcgcctatcggctcgacggcaagactacctatgcgctg
gagggctcgatcttcatcgcgggtgccgccgtgcagtggctgcgcgacgggatcaaggtg
atcggcaaggccgcggagagcggagcgcttgcggagcgttcggacgaaacgcagcagatc
tatctcgtgccggcctttgtggggcttggcgcgccgcactgggacgccgatgcgcgcggc
gcgattttcggactgacccgcaactcaggcccggcggaattcgcgcgcgcggctttggaa
tccgtcgcctaccagacccacgatcttctcgtggctatgaaaagggattgcggcaacacc
ttcggaaaaacggtgctgcgggtggacggcggcatggtcgcctccagctggactatgcag
tgcctcgccgacattctcgacgcgccggtggatagcccgacaatcacggagacaaccgcg
ctgggggccgcctggcttgccggttccaaggccggcatctggcctgacagggcaacattt
gccaagagctgggcgctcgagcgccgtttcgagcctcagatggatggcaggcagcgcaag
gcgaagcttgccggctgggccgacgcggtatcgcgcacgttgacagcgcgtgcgccgtgc
taa

DBGET integrated database retrieval system