KEGG   Chelativorans sp. BNC1: Meso_1628Help
Entry
Meso_1628         CDS       T00374                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00010  Glycolysis / Gluconeogenesis
mes00020  Citrate cycle (TCA cycle)
mes00620  Pyruvate metabolism
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01120  Microbial metabolism in diverse environments
mes01130  Biosynthesis of antibiotics
mes01200  Carbon metabolism
Module
mes_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_1628
   00020 Citrate cycle (TCA cycle)
    Meso_1628
   00620 Pyruvate metabolism
    Meso_1628
Enzymes [BR:mes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Meso_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N Neisseria_TspB Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABG63023
JGI: Meso1628
UniProt: Q11HV2
Position
complement(1753060..1754418)
Genome map
AA seq 452 aa AA seqDB search
MPIQITMPALSPTMEEGNLAKWLVKEGDSVSPGDVIAEIETDKATMEVEAVDEGTVAKIV
VPEGTQGVKVNALIAILAGEGEDAAQAAKASGNGGAAAAPEPKPEAKPEATPSASKQPEE
AENRPAPAAKPAAPQPSADKDGRVFASPLARRIAKDAGIDLSAISGSGPRGRVVRADVEA
AISGGTAKPAAAAPEGPAPAPKPMSDEAVLKLFEEGSYELVPHDGMRKTIARRLVEAKST
IPHFYLTLDCEIDALLALRKQLNDAAPMVKAEAGEKPAYKLSVNDLIIKAWALALKAVPE
ANASWTESAMIKHKHADVGVAVSIPGGLITPIVKRADEKTLSVISNEMKDLAARARNRKL
KPEEYQGGTSAISNLGMFGIKDFAAVINPPHATILAIGAGEERPVVRNGEIKIATVMSVT
LSTDHRAVDGALGAELLTAFKRLIENPFGMLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccagatcaccatgccggccctctcgcccaccatggaagagggcaatcttgcc
aagtggctggttaaggagggggacagcgtttcgcccggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgttgacgagggcaccgtggccaagatcgtc
gtgcccgagggcacacagggcgtgaaggtgaatgcgctgatcgccattctcgccggtgag
ggtgaggacgcggctcaagcggcgaaggcgagcggaaacggtggcgcggcggcggctccc
gaacccaaaccggaggcaaagcccgaggcgacgccttccgcgtctaagcagccggaagaa
gcggagaaccggcctgcgcctgccgctaaaccggccgccccacaaccctccgccgataag
gacggccgcgtttttgcctcgccgcttgcccgccgcatcgccaaggatgccggcattgat
ctgtcggccatatccggttccggcccgcgcggacgcgtggtgagagcggatgtggaggct
gcgatcagcggcggaactgcaaagcctgccgcggcggcgcccgaagggccagctccggct
cccaagcccatgtcggacgaagcggtgcttaaactgttcgaggaaggctcttacgagctc
gtgccgcatgacggcatgcgcaagaccatcgcgcgcaggctggtcgaggcgaaaagcacc
atcccgcatttttatctcacgctcgactgcgagatcgatgcccttctggcgctccgcaag
cagctcaacgacgccgcgcccatggtgaaggcggaggccggcgaaaagcccgcatacaag
ctctcggtcaacgacctgatcatcaaggcttgggcgttggcgctgaaagcggtgccggag
gcaaatgcgtcctggaccgagagcgcgatgatcaagcacaagcacgccgatgtcggggtc
gcggtctctattcccggagggttgatcacgcccattgtaaaaagggccgatgagaagacg
ctgtcagttatctccaacgagatgaaggatttggccgctcgcgcccgcaaccgcaagctc
aaaccggaagagtatcaggggggcacatcggccatttccaacctgggcatgttcggcatc
aaggatttcgcggcagtgatcaatccgccacatgcgacaatccttgcgatcggcgcgggc
gaggagcggcctgtggtcaggaacggagagatcaagattgccacggtgatgtcagtcacg
ctctcgacagaccaccgcgcggtggatggggcgctcggagctgaactgcttaccgccttc
aaacggctgattgagaatcccttcggaatgctcgtctag

DBGET integrated database retrieval system