KEGG   Chelativorans sp. BNC1: Meso_1636Help
Entry
Meso_1636         CDS       T00374                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_1636 (tpiA)
   01230 Biosynthesis of amino acids
    Meso_1636 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_1636 (tpiA)
   00051 Fructose and mannose metabolism
    Meso_1636 (tpiA)
   00562 Inositol phosphate metabolism
    Meso_1636 (tpiA)
Enzymes [BR:mes01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Meso_1636 (tpiA)
Exosome [BR:mes04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Meso_1636 (tpiA)
  Exosomal proteins of bladder cancer cells
   Meso_1636 (tpiA)
  Exosomal proteins of melanoma cells
   Meso_1636 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1762728..1763492)
Genome map
AA seq 254 aa AA seqDB search
MTPTIRPLIAGNWKMHGTESSLGELKAIGSGFVEAAGAGADGVICVPATLLARASDILAK
TPVATGGQDCHPATSGAHTGDIAAEMLADCGASYVIVGHSERRTDHHEADEDVAAKAEAA
WRAGLTAIICIGETKIQREAGETLSVLSRQIAGSVPPGATAKNSVIAYEPVWAIGTGLTP
TVEDVAQAHAHLRAELGMKLGIEADGMRLLYGGSVKPSNAGELLSILNVDGALIGGASLK
AADFLAISAAVKGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacacccacaatccgccccctcatcgccggtaattggaagatgcacggcactgagagc
tcactgggtgagttgaaagccatcggcagcggttttgtggaggccgcgggagcgggagcg
gacggtgtcatttgtgtgccggcaacgctgctggcgcgcgcatccgacatattggcgaaa
acgccggttgcgacgggtggccaggactgccatccggcgaccagcggtgcccatacgggc
gatattgccgctgagatgctggccgactgcggcgcgagctacgtaatcgtcgggcattcg
gaacgccgcaccgatcatcatgaggccgatgaggatgtcgcagccaaggcggaagccgcc
tggcgcgccggcctcactgccatcatctgcatcggggaaaccaagatacagcgcgaggcg
ggcgaaacgctgtcggtgctttcccggcagattgccggttccgttccgccgggagctacg
gcgaaaaattccgtaatcgcctacgagccggtttgggccataggtaccggcctcacgccg
acggtggaagatgtggcccaggcgcacgcccatctgcgtgccgagcttggaatgaagctg
ggtattgaagccgatgggatgcggcttctatacggcgggtcggtgaagccgtcgaatgcg
ggcgaactgctttccatactgaacgtggatggggcgctgattggcggcgccagcctcaag
gctgccgatttcctcgcgatttcggcggctgttaaaggcaaataa

DBGET integrated database retrieval system