KEGG   Chelativorans sp. BNC1: Meso_1639Help
Entry
Meso_1639         CDS       T00374                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mes  Chelativorans sp. BNC1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Meso_1639
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Meso_1639
Enzymes [BR:mes01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Meso_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1766563..1767378
Genome map
AA seq 271 aa AA seqDB search
MADILRKIEAYKREEIAAAKQALPLAEQAARARDAAPIRGFAAALRSKHAAGQFALIAEV
KKASPSKGLIRADFDPPTLAKAYEDGGAACLSVLTDRPSFQGAPEFLTAARAATNLPALR
KDFMFEPYQVFEARAWGADAILIIMASVSDDEAINLSETAGELGMDILLEVHDEAELERA
LKLPSPLIGINNRNLRTFETTLETSERLAPLVPEDRVIVGESGIFTHADCLRLKKVGIST
FLVGESLMRQNDVEAATRSLLGLQRNIEAVS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattcttcgaaagatcgaagcttacaagcgcgaggagattgcggctgcgaag
caagctctacctctggccgagcaggctgcacgggcacgggatgccgctcccatacgcggg
tttgcggcggcgctgcgctcaaagcatgctgcagggcagttcgcgctgatcgcggaggtg
aagaaggcaagcccctccaagggcctcattcgagccgatttcgatcccccaactcttgca
aaagcctatgaagacggtggagctgcctgcctttccgtgctcacggaccgtccctccttc
cagggcgcgcccgagttcctgactgcggcgcgggctgccacgaacctgcctgccctgcgc
aaggacttcatgttcgagccctatcaggtgttcgaagcacgcgcttggggcgcggatgcg
atcctgatcattatggcgagcgtctcggatgacgaggctatcaatctctcggagacagcg
ggcgaactcggcatggacatcctgctggaagtccacgacgaagccgagctggaaagggcg
ctaaaactcccctcgcccttgatcggcatcaacaaccgcaatctccgcaccttcgaaacg
accctggaaaccagcgaacgcctcgcgcctctggtgccggaggatcgagtcatcgtgggt
gagagcggtatcttcacccacgccgattgtctccggctcaagaaagtcggcatttccaca
ttccttgtgggcgaaagcctgatgcgccagaacgatgtcgaggccgcaacgcggagcctt
cttggcctacagcggaatatcgaggcagtgagctga

DBGET integrated database retrieval system