KEGG   Chelativorans sp. BNC1: Meso_1639Help
Entry
Meso_1639         CDS       T00374                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
mes01130  Biosynthesis of antibiotics
mes01230  Biosynthesis of amino acids
Module
mes_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Meso_1639
Enzymes [BR:mes01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Meso_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABG63034
JGI: Meso1639
UniProt: Q11HU1
Position
1766563..1767378
Genome map
AA seq 271 aa AA seqDB search
MADILRKIEAYKREEIAAAKQALPLAEQAARARDAAPIRGFAAALRSKHAAGQFALIAEV
KKASPSKGLIRADFDPPTLAKAYEDGGAACLSVLTDRPSFQGAPEFLTAARAATNLPALR
KDFMFEPYQVFEARAWGADAILIIMASVSDDEAINLSETAGELGMDILLEVHDEAELERA
LKLPSPLIGINNRNLRTFETTLETSERLAPLVPEDRVIVGESGIFTHADCLRLKKVGIST
FLVGESLMRQNDVEAATRSLLGLQRNIEAVS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattcttcgaaagatcgaagcttacaagcgcgaggagattgcggctgcgaag
caagctctacctctggccgagcaggctgcacgggcacgggatgccgctcccatacgcggg
tttgcggcggcgctgcgctcaaagcatgctgcagggcagttcgcgctgatcgcggaggtg
aagaaggcaagcccctccaagggcctcattcgagccgatttcgatcccccaactcttgca
aaagcctatgaagacggtggagctgcctgcctttccgtgctcacggaccgtccctccttc
cagggcgcgcccgagttcctgactgcggcgcgggctgccacgaacctgcctgccctgcgc
aaggacttcatgttcgagccctatcaggtgttcgaagcacgcgcttggggcgcggatgcg
atcctgatcattatggcgagcgtctcggatgacgaggctatcaatctctcggagacagcg
ggcgaactcggcatggacatcctgctggaagtccacgacgaagccgagctggaaagggcg
ctaaaactcccctcgcccttgatcggcatcaacaaccgcaatctccgcaccttcgaaacg
accctggaaaccagcgaacgcctcgcgcctctggtgccggaggatcgagtcatcgtgggt
gagagcggtatcttcacccacgccgattgtctccggctcaagaaagtcggcatttccaca
ttccttgtgggcgaaagcctgatgcgccagaacgatgtcgaggccgcaacgcggagcctt
cttggcctacagcggaatatcgaggcagtgagctga

DBGET integrated database retrieval system