KEGG   Chelativorans sp. BNC1: Meso_1750Help
Entry
Meso_1750         CDS       T00374                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Meso_1750
   00670 One carbon pool by folate
    Meso_1750
Enzymes [BR:mes01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Meso_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1869998..1870501)
Genome map
AA seq 167 aa AA seqDB search
MKLSLVVAVANNGVIGHQGDLPWRLSTDLKRFKAVTMGKPIIMGRKTWQSIGKPLPGRQN
IVISRNPAFTAEGAYAAGSLDEAIALAGRQDGIEEICVIGGAEIYRQALSRADILHVTHV
EADVEGDAVFPEIDPQVWRPVHSESVPAGEKDVYPTRYVIYERRQAV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttctctcgtcgtggctgtcgccaataacggcgtcatcggccaccaaggtgat
ttgccgtggcggttgtccacagatctgaagcgcttcaaagccgtgaccatgggcaagccc
ataatcatggggcgaaagacctggcagagcatagggaagccgctcccgggacgccagaat
atcgtgattagccgcaatcccgctttcacggcggaaggggcgtatgccgccggttcgctt
gacgaggcgatcgcgctggccggccggcaggacggtatcgaggagatctgcgtcatcgga
ggcgcagaaatttaccggcaggcgctttctcgcgccgatatcctccatgttactcatgtc
gaggccgacgtggagggcgatgccgtttttcccgaaatcgatccgcaggtttggcggccc
gttcatagcgaaagcgtgcccgccggcgaaaaggatgtttacccaacgcgctatgtgatt
tacgagcggcggcaggcggtctga

DBGET integrated database retrieval system