KEGG   Chelativorans sp. BNC1: Meso_1755Help
Entry
Meso_1755         CDS       T00374                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mes  Chelativorans sp. BNC1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mes00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mes00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mes03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mes03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mes03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1875081..1875599)
Genome map
AA seq 172 aa AA seqDB search
MPLLPYVINLQAARAMEVLFYHLTESTLEEALPPLVEKSLERGWRVGIQTASEERRDALD
ACLWTFRDDSFVPHATDREPHAAEQPVILTTAPANPNGASIRFLVEGAEPGSLDGYQRAV
FLFDGHDTSQLDAARAHWKAMKAAGHDVTYWQQGPDRRWQRKRERGESAIRQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcccctactgccctacgtcatcaatttgcaggcagcgcgcgccatggaagttctcttc
tatcacctgaccgaatcaacgctggaagaagcgttgcctccgctcgtggaaaaaagcctc
gagcggggctggcgcgtggggatccagacggcgagcgaggagcggcgtgacgcgctcgac
gcctgcctatggaccttccgggacgacagcttcgtgccgcatgcgacagatcgcgagccg
catgcagcggagcagccggtgattctcaccaccgcgccggccaaccccaacggggcctca
atccgctttcttgtcgagggcgcggagcctggatctctcgacggatatcagcgcgccgtt
ttccttttcgatgggcacgacaccagtcagctcgacgccgcgcgggcgcattggaaggcg
atgaaggccgcaggccatgatgttacctactggcagcagggccctgaccgtcgctggcaa
aggaagcgtgagcggggggaatcggcaataaggcagtag

DBGET integrated database retrieval system