KEGG   Chelativorans sp. BNC1: Meso_2236Help
Entry
Meso_2236         CDS       T00374                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mes00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2388345..2390747)
Genome map
AA seq 800 aa AA seqDB search
MDVAKTDVGTPSLSEFEAIDRYWRAANYISVGQIYLMDNPLLREPLTAEHVKPRLLGHWG
TTPGLNFVYVHLNRVIRARDLNVIYVCGPGHGGPAMVANTYLEGTYSEIYPDVPQDAEGL
RRLFRQFSFPGGVPSHAAPETPGSIHEGGELGYALAHAYGAAFDNPDLLVACVVGDGEAE
TGPTAAAWHSNKFLNPARDGAVLPVLHLNGYKIANPTILGRMEDEELRALFTGYGYEPFF
VEGSEPAEMHPLMARTLDTALDRISAIQQQARDPAWSGERLRWPMIVLRSPKGWTGPKEV
DGKKVEDFWRSHQVPVANARGNDEHRRVLQDWMLSYKAQELFDESGRLRPELAALAPSGN
KRMGANPHANGGLLKRDLVLPDWKAYALDVRQPGGLKGEATRVMGTYLRDVMKLNVDNFR
LMGPDETSSNRLDAVFDVTDRVWMERIEPYDVHLTRDGRVMEVLSEHLCQGWLEGYLLTG
RHGLFSCYEAFIHIVDSMVNQHAKWVKVSRELSWRKPIASLNYLLTSHVWRQDHNGFSHQ
DPGFADFVANKKADTIRLYFPPDANTLLWVTDHCLKTYNRINVITAGKQPAPQWLSADEA
EIHCRAGAGVWEWAGTVARDEEPDVVMACAGDVPTLETLAAVDILRTDFPDLKIRVVNVV
DLMTLQSATEHPHGLDDQGFDALFTTDKPVIFAYHGYPYLIHRLTYKRANHDNMHVHGFR
EEGTTTTPFDMVVMNSLDRFHLAIAAATRVTRLDVKADELVARLNDKLVEHAAYIRQHGE
DMPEIRDWGWPYKTAAEAGD
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgccaaaaccgatgtcgggacaccgagcttgtcagagtttgaggcgatcgac
cgttattggagagcggcaaactatatctcggtgggccagatctatctcatggacaacccg
ctgctccgcgagccgctcacggcggagcatgtcaagccccggcttctggggcattgggga
acgacgccgggtctgaacttcgtctacgtccatctgaaccgggtcatccgtgcgcgcgac
ctgaacgtgatctatgtctgcggtccggggcacggcggccccgcgatggtggccaacacc
tatctcgaagggacatacagcgagatctatccggatgtgccccaggatgcggaaggcctg
agaagactattccgccagttctcctttcctggcggggttcccagccatgctgccccggaa
acaccgggctcgattcatgagggcggagaactcggctacgcgctggcgcacgcctacggc
gccgctttcgacaaccccgacttgctggttgcgtgcgtggtcggcgacggcgaggcggaa
accggtcccaccgccgccgcgtggcattccaacaagttcctcaacccggcgcgagacggt
gccgttctgcctgttctccacttgaacggctacaagatcgccaatcccacgatcctcggc
cggatggaagacgaggaactgcgcgctctcttcaccggctatggatatgagccgttcttc
gtggaaggcagcgagcccgccgaaatgcacccgctgatggcgcggacgctcgacacggcg
ctcgaccgcatctccgccattcagcagcaggcacgcgatccggcgtggtcgggagagcgc
cttcgctggcccatgatcgtcctgcgcagcccgaagggctggaccgggccgaaagaggtg
gacggcaagaaggtcgaggacttctggcgttcgcaccaggtgccggttgccaacgcgcgg
ggcaatgacgagcaccggcgcgtgctgcaggactggatgctgagctacaaggcgcaggaa
ctgttcgacgagagcgggcgccttcggccggaacttgcggctctcgcgccttcgggaaac
aagcgcatgggcgccaatccccatgccaatggcgggcttctgaagcgcgacctcgtcctg
ccggactggaaggcatacgccctcgacgtgcggcagccgggaggattgaagggcgaggcc
acgcgcgtgatgggcacctatctacgcgacgtgatgaagctcaacgtggataatttcagg
ctgatggggccggacgagacatcgtccaaccggctcgacgccgtcttcgatgttaccgat
cgtgtctggatggagaggatcgagccctacgacgtgcacctgacgcgcgacggccgtgtc
atggaggtgttgagcgaacatctctgtcagggctggctggagggctatctgctaaccggc
cggcatgggctcttctcctgctatgaagccttcatccatatcgtggattccatggtcaac
cagcacgccaaatgggtgaaggtctcgcgcgagctctcctggcgcaagccgatcgcttcg
ctcaattacctgcttacctcccatgtctggaggcaggaccacaacggcttcagccatcag
gatcccgggttcgccgatttcgtcgccaacaagaaggcggatacgatccgcctctacttc
ccgcccgacgcgaacaccctgctgtgggtgaccgaccactgcctcaagacctacaaccgc
atcaacgtcatcacggccggcaagcagccggcgccgcaatggctgagcgccgatgaggcc
gagatccactgcagggcaggggcgggcgtctgggaatgggcggggacggtggctcgggac
gaagaaccggatgtggtcatggcctgcgccggcgacgtgccgacgctggagacgctggcg
gccgtggatattctgcgcacggatttccctgacctgaagatccgcgtcgtcaatgtggtc
gacctgatgacgctgcaatcggcgacagagcatccgcatggccttgacgatcagggcttc
gacgccctgttcacgacggacaaaccggtgatcttcgcctatcacggctatccctatctc
atccaccgcttgacctacaaacgcgccaaccacgacaacatgcatgtgcacggctttcgc
gaggaaggcacgaccaccacgcccttcgatatggtcgtcatgaattcgctcgaccggttc
catctcgccattgccgccgccactcgcgtgacgcggctggacgtcaaggcggacgaactg
gtcgcacggctcaacgacaagctcgttgagcacgccgcctatatccgccagcacggcgag
gacatgcccgagatccgcgattgggggtggccctacaagacggccgccgaagccggtgac
tga

DBGET integrated database retrieval system