KEGG   Chelativorans sp. BNC1: Meso_2421Help
Entry
Meso_2421         CDS       T00374                                 

Definition
glycoside hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mes  Chelativorans sp. BNC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Meso_2421
Enzymes [BR:mes01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Meso_2421
Exosome [BR:mes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Meso_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2593989..2595770)
Genome map
AA seq 593 aa AA seqDB search
MQEGMGAIVHGNGVAFRVWAPHADAVSVVGTFNDWSDEAAPMTAEDGGFWYADLPSAKPG
DEYRFLIRNGEKRLSRIDPYARAVTNSVGNGIIVEQQDDWHEAEFETPPWNELVIYEMHI
GTFHRPQDNELGTFDDATERLAHLKRLGINAVQIMPAMEFAGDISWGYNPAHIFAIESSY
GGPAAFKAFINAAHKQGIAVILDVVYNHFGPSDLDLWQFDGWSEDDKGGIYFYNDWRSDT
PWGDTRPVYGRGEVRQFIRDNALFWLEEYHLDGLRFDMTLYIRNVRGDEGDEGDAIPEGW
SLLQWVNSEIRERLPGRITIAEDLRNKAEITGAVDEGGAGFGAQWDSEFVHPIRETLIAP
DDESRHMGTVAHALGHSYNGDPFQRVVYTESHDEVANGKARIPHEIAPGDPSHWAAQKRS
TLGAALMLTAPGIPMLFQGQEFLQGEWFQDTVPLDWDQSEEFKGIVRLYRDLIRLRRNQM
SVTSGLLGRNTRIFRVDEEKKLIAFHRWVEGGPRDDVVVVANFSHQAYASYRMGFPRQGL
WNLRLNTDWSGYSPDFGSFESHDVVAEAVECDGLSWSGEVAIGPYTALVFSQD
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagggtatgggcgcgatcgtccacggaaacggcgtggcattccgcgtttgggct
cctcatgccgacgcggtgtcggtcgtcggcactttcaacgactggtcggacgaggccgcg
ccgatgaccgccgaagatggcgggttctggtacgcggacctgccttccgcaaagcccggc
gacgaataccggttcctaatccgtaacggcgaaaaacgcctgtcgcgcattgacccttat
gcccgcgctgtgacgaattcggtcggcaacggcatcatcgtcgagcagcaggacgactgg
catgaggccgaattcgaaacaccgccatggaacgagttggtcatctacgagatgcacatc
ggcaccttccatcggccgcaagacaatgagctcggtacgttcgacgatgccaccgaaagg
cttgcccatctgaagcgccttgggatcaatgctgtgcagattatgccagcgatggagttc
gccggcgatatctcctggggatacaacccggcgcatatctttgccattgaaagctcctat
ggcgggccggctgccttcaaggcctttatcaacgcggcgcataagcaggggatcgctgtc
atcctcgacgtggtctacaaccatttcgggccgagtgatctcgatctctggcagttcgac
ggctggagcgaagacgacaagggcggcatttatttttacaacgactggcgcagcgatact
ccatggggcgatacgcgtcccgtttacggccgcggtgaagtccgccagttcatccgagac
aatgcccttttctggctcgaagagtaccatctcgacggtctgcgtttcgacatgacgctc
tacattcgcaatgtgcgcggcgacgaaggggatgagggcgatgcaatccccgagggctgg
agcctgttgcagtgggtcaacagcgaaatccgcgagcgccttcccggccgcattaccatc
gccgaggacctgcgcaacaaggcggaaatcacaggcgcagtcgatgaaggcggcgcaggg
ttcggcgcgcaatgggattctgagttcgtgcacccgatccgcgagacgctgattgcgcct
gatgatgagtcccggcacatgggaaccgtcgcccatgcgctcggccattcctataatggg
gatcctttccagcgggtcgtctataccgaatcccatgacgaagtggccaatggaaaggct
cgcatcccgcatgagatcgcgccgggcgacccttcgcattgggcggcgcaaaagcgctca
acgctgggtgccgcgctcatgcttacggcccccggcattccgatgctgttccagggccag
gagtttctgcaaggcgaatggttccaggatacggttcctctggactgggatcagagcgag
gaattcaagggcatcgtccgcctctaccgcgatctcattcgcctgcgccgaaatcaaatg
tcggtcacgtccggcctgcttggccgaaatacccgaatcttcagggtcgacgaggaaaag
aagcttatcgcctttcaccggtgggtcgaaggcgggccgcgggacgatgtcgtcgtcgtc
gcaaatttcagccatcaggcatatgcatcctatcgcatgggctttccaaggcagggcctt
tggaacctccgtctcaacacggattggagcggctacagcccggatttcggcagtttcgaa
agccacgatgtggttgccgaagccgtggaatgcgatgggctctcctggtctggagaggtg
gcgataggtccctacaccgcgcttgtgttctcacaagactga

DBGET integrated database retrieval system