KEGG   Chelativorans sp. BNC1: Meso_2469Help
Entry
Meso_2469         CDS       T00374                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00250  Alanine, aspartate and glutamate metabolism
mes01100  Metabolic pathways
mes01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Meso_2469
Enzymes [BR:mes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Meso_2469
Peptidases [BR:mes01002]
 Cysteine Peptidases
  Family C44
   Meso_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans DUF3700
Motif
Other DBs
NCBI-ProteinID: ABG63853
JGI: Meso2469
UniProt: Q11FH2
Position
complement(2646868..2648643)
Genome map
AA seq 591 aa AA seqDB search
MCGICGEVRFDGRTPSVSAISGMMEALAPRGPDGAGIVSHGNAGFGHRRLRIIDLSEKAQ
QPMVDSALGLTIAFNGCIYNYPELREALEAKGYSFFSHGDTEVILKAWHAWGETCVERFH
GMFAFVIQERDTGRIVMARDRFGIKPLYLAEKSGVLRFASSLPALVKAGDVDTSIDRVAL
HHYMTFHAVVPPPRTILNGVRKLPPATIRVIEADGRSTERRYWDPPYRRDPADAGVSAEE
WRDRVHEALRLAVKRRMVADVPVGVLLSGGVDSSLIVGLLAEAGQTGLMSFSVGFEEANG
EKGDEFVYSDLIAKEFGTDHHKIFVPSDRLMDALPGTFAAMSEPMVSYDNVGFYLLSQEV
SKHIKVVQSGQGADEVFGGYHWYPPLARSNDVVADYAKVFFDRSHETLKRQLGANWINGE
DYSRGLVAAELMRPGADSPVDRALRLDANVMLVDDPVKRVDNMTMAWGLEARVPFLDHEL
VELAARIPPEEKLKDGGKGVLKDVARLVVPHEVIDRPKGYFPVPQLKYVAGPYLEMVRDA
LGSQRARERGLFRQDYLDRLFAQPADHITPLRGSELWQAGLLELWLQTHGI
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttgcggtgaagtgagatttgacggccggactccgtccgtatcggccata
tccggaatgatggaagcgctggctccgagagggcccgacggcgcgggcatcgtgtcccac
ggcaatgcgggattcggccaccggcggctcaggatcatcgatctttcggaaaaggcgcag
cagccgatggtggactccgcgttgggcctgaccatcgccttcaacggctgcatctacaat
taccccgagctgcgcgaggcgctcgaggcaaagggctatagctttttctcgcacggcgac
acggaggtcatcctcaaggcgtggcatgcctggggtgaaacctgcgtggagcgcttccat
ggcatgttcgctttcgtgatccaggagcgcgacaccggccgtatcgtgatggcgcgggac
cgcttcggcatcaagccgctctacctcgccgagaagagcggcgtgctccgcttcgcctcc
tcgctcccggcgctcgtgaaagccggggacgtggatacctccatcgaccgggtggcgctg
catcactacatgaccttccacgcggtcgttccgccgccccgcactatcctcaatggtgtg
cgcaagctgccgcccgccacgatccgcgtcatcgaggccgacggccgctcgacggaacgg
cgctactgggatccgccctatcgccgcgacccggccgatgccggcgtttcggcagaagag
tggcgcgaccgtgtgcacgaggcgctacggcttgccgtgaagcggcgcatggtggctgat
gtacccgtgggcgtgctgctttcaggcggtgtggattcgagcctcattgtcggccttctg
gccgaggccggccagaccgggctcatgagcttttccgtcggtttcgaggaagcgaatggc
gagaaaggggacgagttcgtctattccgacttgatcgcgaaggagttcggcaccgatcat
cacaagatattcgtgccttccgaccggctgatggatgcgctccccggcaccttcgccgcc
atgtccgagccgatggtgtcctacgacaatgtgggcttctatctgctctcgcaggaggtt
tccaagcacatcaaggtggtgcagtcggggcagggagctgacgaggtgttcggcggctat
cactggtatccgccgcttgcccgctccaacgacgtggtggcagactacgcaaaggtcttc
tttgaccgctcgcacgagacgctgaagcgtcagctcggagcgaactggatcaatggcgaa
gactacagccgcggccttgtcgccgcggagctgatgcggccgggtgcggactcgcctgtc
gatcgtgctttgaggctcgatgccaatgtgatgctggtggacgatccggtgaagcgggtc
gacaacatgacgatggcctgggggctggaggctcgtgttcccttcctcgatcacgagctg
gttgagctcgccgcgcgcattccgcccgaagaaaagctgaaagacggcggcaaaggcgtg
ctcaaggatgtggcccggcttgtcgtgccgcatgaggtcatcgatcgaccgaagggttat
ttcccggtgccgcagctcaaatatgtggccggtccctatcttgagatggtgcgtgacgcg
ttgggctctcaacgcgctcgcgagcgcgggctgtttcgccaggattatctcgatcggctt
ttcgctcagcccgccgaccacatcacgccgctgcgcggttccgagctctggcaggccgga
cttctggaattgtggcttcagacccatgggatctag

DBGET integrated database retrieval system