KEGG   Chelativorans sp. BNC1: Meso_2674Help
Entry
Meso_2674         CDS       T00374                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mes  Chelativorans sp. BNC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Meso_2674
Enzymes [BR:mes01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Meso_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2901825..2903648)
Genome map
AA seq 607 aa AA seqDB search
MSEEVDRLAAAHGVLRSYRALDGTISRASDDAVQAILNILGVEEGAAPQAAAASGPFPPP
PQAAEGAACFLPDFLQQGRAWGVTCQLYGLRSHRNWGIGDFEDLARLGELVARMGADFLG
VNPLHALFLAEPQKASPFSPSDRNFLNPLYIAVDQVEGFDPGLDLDESALALLRESKLVD
HKAVADHKLSVLRGIYERTRGTDGQGLDAFKERGGEALWRYGLFEAISLEMVRRGIGTGW
HPWPEAFKDPASEAVGQFAREHQGEIEFLVWLQWVADRQLEQASKRLQAAGMRIGLYLDL
AVGTAPDGAATWSDRTLTVVGAEIGAPPDMFNPEGQRWGLAPWSPSEIAAREFRPVRRSY
EAILRHAGALRIDHAMGLYRLFWIPDGFPAGEGAYVIYPMPDVVRVLAEVSQGSRALIIG
EDLGVVPEGFREQMDRANLLGYRIFYFERDDHNFVPPERWPRSALACVGSHDTNTLAGWW
TGSDIDERQRIGLYDEEAARKERERRQREKSQAIEILRARGQPEIGEEFNESVAAGIHRL
VASSPSRLVAAQMEDLLGLAEQSNIPGTVDEHPNWRRKLPVFIEELESASMLRAVIGAIR
EERPRGT
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggaagttgaccggctggcagccgcgcacggtgtcctgcgctcctatcgcgcg
ctggacggaaccatctcgcgcgcatcggatgatgccgtacaggcgatcctgaatattctg
ggcgtggaggaaggtgccgcgcctcaggctgccgcagcatccggcccgtttcctccgccg
cctcaggctgccgaaggcgccgcgtgttttcttcccgattttctgcaacagggcagggcg
tggggcgtcacctgccagctctacggactgcggtcccaccgcaactggggcatcggcgat
tttgaggatctggcgcgtcttggcgagctcgtggcacgaatgggagccgattttctgggc
gtcaatcccttgcatgcgctcttcctggcagaaccgcagaaggcgagcccgttttcgccg
agcgaccggaattttctaaacccgctctatatcgccgtcgatcaggtggaggggttcgac
cccggcttggatctggacgagagcgctcttgctttgttgagggagagcaaactggtcgat
cacaaggccgtggcggaccacaagctttcggtgctgcgcgggatttacgagcggacgcga
gggactgacgggcaaggactcgacgctttcaaggagcgcggcggagaggcgctgtggcgc
tatggtctgttcgaggcgatcagcctggaaatggtacgccgcggcatcggtaccggctgg
catccctggccagaggcgttcaaggatcccgctagcgaggcggtgggacagttcgcgcgg
gagcaccagggggagatcgagtttcttgtctggttgcagtgggtggcggaccggcaattg
gagcaggcttcaaagcggctgcaagccgccgggatgcgcatagggctttatctcgacctt
gccgtgggcaccgcgcccgatggtgcggccacatggagcgaccgcacgctgaccgtggtc
ggggcggagatcggtgcgccgccggatatgttcaatccggaaggccagcgctggggtctg
gcgccgtggtcgccttccgagatcgctgctcgggaattccggccggtgcgccgctcctac
gaggcaatcctgcggcatgcgggggctctcaggatcgaccatgcaatggggctttaccgg
cttttctggatcccggacggctttcccgcaggggagggcgcttacgtgatttatccgatg
ccggacgtggttcgcgttctggccgaggtatcgcaaggatcgagagcgcttatcatcggc
gaggatctgggggtggtgccggagggttttcgcgagcagatggaccgtgcaaacctgctg
ggctaccgcatcttctatttcgagcgggacgatcataattttgttccgcccgaacgctgg
ccgcgatcggccttggcctgcgtcgggagccacgacaccaacacgctcgccggctggtgg
acaggcagcgatatcgatgagcgccagcggataggcctttatgacgaggaagcagcgcgt
aaggagcgcgagcgcaggcagcgggaaaaaagccaggcgatagaaatactgcgcgcccgc
ggccaaccggagatcggcgaagaattcaatgaaagcgtcgcggccggcattcatcggctg
gtggcgtcttcgccttcgcgcctcgttgccgcccagatggaagatctgcttggattggcg
gagcagtcgaacatacctggaaccgtggacgaacatcccaactggcggcggaagcttccc
gtcttcatcgaggaactggagagcgcttcgatgctgcgtgccgtcatcggcgcaatccgg
gaagaaaggccgcgcggtacatga

DBGET integrated database retrieval system