KEGG   Chelativorans sp. BNC1: Meso_2747Help
Entry
Meso_2747         CDS       T00374                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Meso_2747
Enzymes [BR:mes01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Meso_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2993407..2994378
Genome map
AA seq 323 aa AA seqDB search
MADLLREIPENPVPPGAISGMMTARDRRRIRYALFPSSGEYGTVVILPGRNECIEKYFET
VRDLSERGFAVAMLDWRGQGGSDRLLKDPRRGHVRSFNQYTSDLDQFFREVVLPDCRPPF
TVLGHSTGSLAALLAAPYLTTRVRRMVLVAPLLEIQTSLPLGPAKMLAKLLCAVGLGRIY
IAGRSRRGKEVPFQPNVLTSDQERHSRNQALLHAFPELFVGGPTAAWLNAAWSAIKRVND
PDFQASVRIPILFLAAGMDRVVSTPAIERYARCLRSARVLTIDGARHEILQEVDMFREQA
LAAFETFAKGHQERAAANEPVGM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctgctccgcgaaattccggaaaaccccgtgccgcccggcgcaatatcgggc
atgatgaccgcacgcgaccgtcggcgcatccgctacgctctattcccctcctccggcgag
tacggaaccgtggtcatcctgcccgggcgcaacgaatgtatcgagaaatatttcgagacg
gtgcgcgacctgtcggagcgcggcttcgcggtggcaatgttggattggcgcggccaaggt
ggatcggaccgtcttctcaaggatcctcggcgtggacatgtgcggtccttcaaccaatac
acctccgatctcgaccagttcttccgcgaggtcgtgctgccggattgccgcccccctttc
accgtgctcggccactcgaccggctcgcttgcggctttactcgccgcaccttatctcacc
acccgcgttcgacgcatggtgctcgttgcgccgctgcttgaaatccagacctcgcttccg
cttggcccggcgaaaatgcttgcaaaactgctctgcgccgtcggccttggccgcatctat
attgccgggcgaagcaggcgcgggaaggaagtccctttccagcccaatgtattgacgagc
gatcaggaacggcacagccgaaaccaggcgctcctccacgcctttccggagctttttgtg
ggaggccctacagctgcgtggctgaatgcggcctggtcggcgataaagcgcgtcaacgac
cccgatttccaggcatcggttcgcattcccattctcttcctggcggccgggatggacagg
gtggtttcgacgcccgcgatcgagcgctatgcgcgctgcctgcgctcggcaagggtgtta
accatcgacggtgcgcggcatgaaattctgcaggaggtcgatatgtttcgggaacaggct
ctcgccgccttcgagaccttcgcaaagggccaccaggaaagagccgccgcaaacgagcct
gtggggatgtag

DBGET integrated database retrieval system