KEGG   Chelativorans sp. BNC1: Meso_2884Help
Entry
Meso_2884         CDS       T00374                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mes  Chelativorans sp. BNC1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mes00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3136878..3138818)
Genome map
AA seq 646 aa AA seqDB search
MCGFGGYFGAGVSEAEPLLRRMASAIAHRGPDERGTAVLDGAGLCHTRLSIVGLADGQQP
MSLDGGRLTIAFNGEIFNYVELREALIARGRTFRTASDTEVILHLYDEKGPDCLADLNGD
FAFAIWDAPRRRMFLARDRMGVRPLFYTSVGDRLFFASEVKTLLQVPGVEAEMDPFALDQ
MFTLWAPIAPRTAFKNIHELEPGHMMLVEEGRQAIRPYWSLSFPEHGAPSRHTDERAVAE
ELRALLTDATRLRMRADVPVGSYLSGGLDSSVISALAAGMTPEILRTFSVAFESAEHDES
AFQNEVAAALGTMHASVNCGDGDIAAVFPDVIRFTERPILRTAPAPLFKLSALVRERGLK
VVLTGEGADEVFAGYDIFKEARVRRFCARQPGSRMRPHLFRKLYPYLPGLKQQSAEYLAA
FFGAGADSLDDPLFSHKPRMRATGAAKLFFSAQLRETLAGYDAAEELASRLPQEFPRWHP
LHQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFPFLDHRLVEFATTLPPEMKLKGLVE
KHILREATKGLLPESILRRTKQPYRAPDSASFRGAGEKDYVREAMSAEKLADCGLFNPAS
VSKLFAKSRQQPLSGFRDNAAFVGILSSQLWLETFTGSRIRAVEAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgggttcggcggatatttcggcgcgggcgtttctgaggcggaaccgcttttgcgg
cggatggcctcggccatcgcccatcgcgggccggacgagcgcggcaccgccgtactcgat
ggtgcgggcctttgccatacgcgcctttccatcgtcggtcttgccgacggccagcagcct
atgtctcttgatggcggcaggctcaccatcgccttcaacggcgagatcttcaattacgtg
gaattgcgcgaggcgctgatcgcccgcggccgcaccttccgcactgcgagcgacacggaa
gtcatcctccatctctatgacgagaagggaccggactgccttgccgacctgaacggcgat
ttcgctttcgccatctgggatgcgccacgccgccgcatgtttcttgcacgcgaccgcatg
ggcgtgcgtccgctcttctatacgagcgtgggcgaccggctcttcttcgcttcggaagtc
aaaacgctcctgcaggtgccgggtgtcgaggcggagatggatccgttcgcgctcgaccag
atgttcacgctctgggcgcccatagctccccgcaccgccttcaagaacattcacgagctt
gagcccgggcacatgatgctcgtcgaggaagggcgccaggcgatccggccctactggtcg
ctttctttcccggaacatggcgcgcccagccgccacacggatgagcgcgccgtggcggaa
gagctgcgggcactgctcaccgacgcgacacggctgcgcatgcgcgccgacgtgccggtt
ggctcctatctttcgggcggcctcgactcctccgtgatctcggcgctggcggccggcatg
acgccggagatcctgcgcaccttctccgttgcgttcgaaagcgccgagcacgatgagagt
gccttccaaaacgaggtggcggcagcacttggcacaatgcatgcctccgtcaattgcggc
gacggtgacatcgccgcggttttccccgatgtgatccgttttaccgaaaggccgatcctg
cgcaccgcgcccgccccgctcttcaagctttcggcgctggtgcgcgaaaggggcctgaaa
gtggtgctcacgggcgagggggccgacgaggtcttcgccggctacgacatcttcaaggag
gcgcgggtgcgccgcttctgcgcgcgccagcccggctcgcgcatgcgtccgcatctcttc
cgcaagctctacccttatctgcccgggctcaagcagcaatcggccgaatatctcgccgcc
tttttcggtgcgggcgcggattcgctcgatgatccgctcttctcgcacaagccccgcatg
cgcgcgacgggtgcggccaagctcttcttctccgcccagctgcgcgagacattggccggt
tacgatgcggcggaggagcttgcctcacgcctgccgcaggagtttccccgctggcatccg
ctgcatcaggcgcaatatctggagtcccgcttcctgctccccggctacatcctttccagc
cagggcgaccgcatggccatggcacacggcatcgaagggcgcttccccttcctcgatcac
cggctggttgagttcgccaccaccctgccgccggagatgaagctgaagggcctggtcgaa
aagcacattctgcgcgaggcgaccaagggcctcctcccggaatcgatcctgcgccgcacc
aagcagccataccgtgcgcccgacagcgcctcattccgcggagcgggcgagaaggactat
gtccgcgaggcgatgagtgcggaaaaacttgccgactgcggacttttcaacccggcatcc
gtgtccaaactcttcgccaagagccgtcagcagccgctttccggctttcgcgacaatgcc
gcttttgtcggcatcctttcgtcccagctatggctggagaccttcaccggttcacgcatt
cgcgccgtcgaggcggcataa

DBGET integrated database retrieval system