KEGG   Chelativorans sp. BNC1: Meso_2922Help
Entry
Meso_2922         CDS       T00374                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
mes  Chelativorans sp. BNC1
Pathway
mes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mes00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Meso_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ABG64294
JGI: Meso2922
UniProt: Q11E81
Position
complement(3175699..3176100)
Genome map
AA seq 133 aa AA seqDB search
MSPMKISRTFRLVSVLVAMVYTSGPAFAEGDAVAGKAVFEKNCQVCHEAEKMRNGAGPYL
LGVVGRPAASTDFPRYSQALKDSGIVWDPENISAFISGPKAFVPGTRMFFTGLKTEEEIA
NVVAYLVEVSKAK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagccccatgaagatcagtcggacctttcgattagtcagcgttctcgtggccatggtt
tatacgagtggcccggcgtttgccgaaggcgacgcggtggctggcaaggcggtgttcgag
aagaactgccaagtgtgccacgaggcggaaaagatgcgcaacggcgccgggccttacctg
ctgggtgttgtcggcaggccggcggcctccacagactttccccggtacagccaagcgctc
aaggattcaggaattgtctgggatcccgaaaatatcagtgccttcataagtggcccgaag
gcattcgtgcctggcactaggatgttcttcactggccttaagaccgaggaggagatcgcc
aatgttgtggcctatctcgttgaagtgtccaaggccaagtag

DBGET integrated database retrieval system