KEGG   Chelativorans sp. BNC1: Meso_3207Help
Entry
Meso_3207         CDS       T00374                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mes  Chelativorans sp. BNC1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Meso_3207
Enzymes [BR:mes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Meso_3207
    3.5.1.-  
     Meso_3207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3475725..3476336
Genome map
AA seq 203 aa AA seqDB search
MEADMTKEALIVIDVQNDFCPGGALAVERGDEVVPVVNGLIQRFDHVILTQDWHPAGHSS
FASSQPGKAPFETVLMPYGEQTLWPDHCVQGTSGADFHPGLEWTKAELVIRKGFRSAIDS
YSAFFENDHETPTGLSGYLRERGIGKVTLAGLATDFCVAYSALDARRQGFEATVILEACR
AIDLGGSLAVMTERMKAAGVELV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggacatgaccaaggaagcgcttatcgtcatcgacgtccagaacgatttctgc
cccggcggcgcgctggcggtggagcgcggagatgaggtcgtgcctgtagtcaatggcctc
atccagcgcttcgaccatgtgatcctgactcaggactggcaccccgccggtcactcgagc
tttgcgtcttcccagcccggcaaggctccgttcgagacggttctgatgccctatggcgag
cagacgctctggcccgaccattgcgtgcaggggacgagcggggccgatttccatcccgga
ctggaatggaccaaggcggaactcgtcatccgcaagggcttccgcagtgcgatcgacagc
tactctgccttcttcgagaacgatcacgagacgccgacgggactttccggctatctgcgt
gaacgcggtatcggaaaagtgacgctggccgggctcgccacggatttctgcgtcgcctat
tcggcactcgatgcgcggcgacagggattcgaagcgacggtcatcctggaagcttgccgc
gcgattgatcttggcggctcgcttgcggtcatgacggagcgaatgaaagcagccggggtg
gaactggtttga

DBGET integrated database retrieval system