KEGG   Chelativorans sp. BNC1: Meso_3207Help
Entry
Meso_3207         CDS       T00374                                 

Definition
(GenBank) isochorismatase hydrolase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00760  Nicotinate and nicotinamide metabolism
mes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Meso_3207
Enzymes [BR:mes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Meso_3207
    3.5.1.-  
     Meso_3207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ABG64579
JGI: Meso3207
UniProt: Q11DE6
Position
3475725..3476336
Genome map
AA seq 203 aa AA seqDB search
MEADMTKEALIVIDVQNDFCPGGALAVERGDEVVPVVNGLIQRFDHVILTQDWHPAGHSS
FASSQPGKAPFETVLMPYGEQTLWPDHCVQGTSGADFHPGLEWTKAELVIRKGFRSAIDS
YSAFFENDHETPTGLSGYLRERGIGKVTLAGLATDFCVAYSALDARRQGFEATVILEACR
AIDLGGSLAVMTERMKAAGVELV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggacatgaccaaggaagcgcttatcgtcatcgacgtccagaacgatttctgc
cccggcggcgcgctggcggtggagcgcggagatgaggtcgtgcctgtagtcaatggcctc
atccagcgcttcgaccatgtgatcctgactcaggactggcaccccgccggtcactcgagc
tttgcgtcttcccagcccggcaaggctccgttcgagacggttctgatgccctatggcgag
cagacgctctggcccgaccattgcgtgcaggggacgagcggggccgatttccatcccgga
ctggaatggaccaaggcggaactcgtcatccgcaagggcttccgcagtgcgatcgacagc
tactctgccttcttcgagaacgatcacgagacgccgacgggactttccggctatctgcgt
gaacgcggtatcggaaaagtgacgctggccgggctcgccacggatttctgcgtcgcctat
tcggcactcgatgcgcggcgacagggattcgaagcgacggtcatcctggaagcttgccgc
gcgattgatcttggcggctcgcttgcggtcatgacggagcgaatgaaagcagccggggtg
gaactggtttga

DBGET integrated database retrieval system