KEGG   Chelativorans sp. BNC1: Meso_3245Help
Entry
Meso_3245         CDS       T00374                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mes  Chelativorans sp. BNC1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_3245
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Meso_3245
   00650 Butanoate metabolism
    Meso_3245
  Energy metabolism
   00190 Oxidative phosphorylation
    Meso_3245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3512890..3513273)
Genome map
AA seq 127 aa AA seqDB search
MADMRTPLNKVRGLGSARGGTEHFWRQRLTAVSNIPLIIFFIGFVAAYSGSSYEEIRAAL
AQPVSALLMGLAFVSVLYHMRLGMQVIIEDYVHGEGWKIALILLNTFFPVIVGAIALYSL
LRIAFGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatgcgcacacctctcaacaaggtccgcggtctgggctcggcgcgcggcggc
acggagcacttttggcgccagcggctgacggcggtctccaatatcccgctcatcatcttc
ttcatcggctttgtggcagcttattccggatcctcctacgaggagatccgggcagcgctt
gcgcagcctgtcagcgcgctccttatgggccttgccttcgtttcggtgctgtaccacatg
cgcttgggaatgcaggtgatcatcgaggattacgtgcatggcgagggctggaagatcgca
ctcatcctcctcaatactttctttcccgtcatcgtcggcgcgatcgcgctctattccctc
ctcagaattgccttcggaggctga

DBGET integrated database retrieval system