KEGG   Chelativorans sp. BNC1: Meso_3350Help
Entry
Meso_3350         CDS       T00374                                 

Definition
lipolytic protein G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mes  Chelativorans sp. BNC1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Meso_3350
Enzymes [BR:mes01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Meso_3350
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Meso_3350
Lipid biosynthesis proteins [BR:mes01004]
 Fatty acid synthase
  Component type
   Meso_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3619905..3620585)
Genome map
AA seq 226 aa AA seqDB search
MAIKFLGKFLAAVSPLAKMLSAAAALFVVLAAQLPAQAEPFNIVGFGDSLMAGYELGPGE
GFTDRLQAALRERGHEVTVANAGVSGDTTSGGLSRLDWSVPDGTDLVILELGANDMLRGV
APASTEKNLEEIITRLKARDIRILLVGMYAAPNLGPDYQQAFNSIYPRLAEKHELPLVPF
FLEGVAGNASLQLADGMHPNAQGIDLMVKNVLPEVELLLQGDKPNM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaattcttgggcaagtttttagccgctgtctcgcccctcgcgaaaatgtta
tcggcggcggccgctcttttcgtcgttttggccgcccaactgcccgcccaggcggagcct
ttcaacatcgtcggcttcggcgacagcctgatggcaggatatgagctcggccccggcgaa
ggcttcacggacaggttgcaagccgcgctgcgcgagcgcggccatgaggtgacagtcgca
aacgccggggtgtcgggcgatacaacgagtggcggactgtcgcgtttggactggtccgtg
cccgacggcaccgacctggtgatcctcgaactcggcgcaaacgatatgctgcgcggcgtc
gcgcccgcttccacggaaaagaacctggaagagatcatcacaaggctaaaggcgcgggac
ataaggattctgctggtcggaatgtatgccgctccaaatctcgggcctgactaccaacag
gccttcaattccatctatccgcggcttgcggaaaaacacgagctgccgcttgtgcccttc
ttcctcgagggcgttgccggaaacgcatcgctccagctcgccgatggaatgcatcccaac
gcgcaggggatcgatctcatggtgaagaacgttctgcccgaggtggaactccttcttcag
ggggacaagccgaacatgtga

DBGET integrated database retrieval system