KEGG   Chelativorans sp. BNC1: Meso_3399Help
Entry
Meso_3399         CDS       T00374                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mes  Chelativorans sp. BNC1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_3399
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Meso_3399
  Amino acid metabolism
   00310 Lysine degradation
    Meso_3399
Enzymes [BR:mes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Meso_3399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3675039..3676325
Genome map
AA seq 428 aa AA seqDB search
MATEIRVPTLGESVTEATIGRWFKKVGDAIAADEPVVELETDKVTVEVPAPSAGTLQEIA
VKEGDTVEVGALLGSIGEGAAAAPAKAAPAAREKKEAVAQAAGASGAGSTGEAIEKTANV
GGEPPIEERKRPPAPSAAKLLAENRLSTDEVAGSGKDGQVLKGDVLAAIERGGRGAPSQP
AELPKVARAPSAPEDEVREERVKMTRLRQTIARRLKDAQSNAAMLTTFNEVDMTAVMDLR
KKYKDLFEKKHGVKLGFMGFFTKAVCHALKEIPAVNAEIDGTDIIYKNFCHIGVAVGTER
GLVVPVVRDADRMTIAEIEKEIGRLGAEARDGKLALADMQGGTFTISNGGVYGSLMSTPI
LNAPQSGILGMHKIQERPMVVGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKDVLED
PERLVLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaattcgcgttcctaccctgggcgaatccgttaccgaggccaccatcggc
cgctggtttaagaaggtcggcgacgcgatcgccgccgacgagccggtggttgaactcgaa
accgacaaggtgactgtggaagtgccggcgccctccgcgggcacgctgcaggaaattgcc
gtaaaggaaggcgacaccgttgaggtcggcgccctcctgggctccatcggggagggtgct
gcggcagctccagccaaggctgctcccgccgctcgggaaaagaaggaagcggtggcccag
gcggctggcgcttcaggcgcgggcagcaccggcgaggccatcgaaaagacggcgaatgtg
ggcggcgagccgccgatcgaggagcgcaagcggccccccgcaccttccgccgctaagctt
ttggccgagaacaggctttcgactgacgaagtggccggctccggaaaggacggccaagtg
ctgaagggcgacgtgctcgccgccatcgagcgtggtgggcgtggcgcgcccagccagccg
gctgaacttccgaaagttgcccgcgcgccttcagcgccggaagatgaggtgcgtgaagag
cgcgtgaagatgacgcgccttcgtcaaacgattgcacgccgcctcaaggacgcgcagagc
aacgccgccatgctgaccaccttcaacgaggtggacatgacggcagtcatggacctgcgc
aagaagtacaaggacctgttcgagaagaagcatggcgttaagcttggcttcatgggcttc
ttcaccaaggcggtctgtcatgcgctgaaggaaatcccggctgttaacgccgagatcgac
ggtaccgacatcatctacaaaaatttctgccatatcggcgtggccgtcggcacggaacgt
gggctcgtggttccggtggtgcgcgacgccgaccgcatgaccatcgctgaaatcgagaag
gaaatcggccgtctcggcgcggaagcccgtgacggcaagctcgcgctggccgatatgcag
ggcggcacgttcaccatttccaatggcggcgtctacggctcgcttatgtcgacgccgatc
ctaaatgcgccgcagtcgggcatcttaggtatgcacaagatccaggagcgcccgatggtc
gtgggcggccagatcgttgtccgcccgatgatgtatctggcgctctcctacgatcaccgc
atcgtcgacggcaaggaggccgtcaccttcctcgtccgcgtcaaggatgtgctcgaggat
cccgagcgcctggtgcttgacctctaa

DBGET integrated database retrieval system