KEGG   Chelativorans sp. BNC1: Meso_3457Help
Entry
Meso_3457         CDS       T00374                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mes  Chelativorans sp. BNC1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Meso_3457
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Meso_3457
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Meso_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3734704..3735876)
Genome map
AA seq 390 aa AA seqDB search
MSGISLSSYRRVTVKIGSALLVDRAAGLKREWLAALVDDIARLMSAGTEVLVVSSGAIAL
GRTVLGLGKRTLRLEESQAAAAVGQIALAGAWSGELGRHGLISGQVLVTLGDTEERRRYL
NARATISTLLKMKAVPVINENDTVATSEIRYGDNDRLAARVATMMGGDLLILLSDVDGLY
TAPPERDPAAKFIPVVDAITPEIMAMGGAAASELSRGGMRTKLDAGRIATAAGTAMIIAS
GKERGPLSAIERGARATLFKPSPTPVRAYKTWIAGQLEPAGRIGIDDGALRALLQGKSLL
PAGVRRVEGVFSRGDTVAIVDSAGREIGRGLVAYDAADAVKIAGLKTGDIAGILGYEARA
AMVHRDDLVLSGPTGELMDRKVEGIDVAGA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaatttcgctttcctcttatcgccgcgtgaccgtgaagatcggctctgccctg
ctggtcgatcgcgcggcagggttgaagcgtgagtggctcgccgcccttgttgacgatatt
gcccggctcatgtcggctggcacggaagtgctcgttgtatcctccggcgccattgccctg
ggacgcacggtgctgggccttggaaagcgcacattaaggctcgaggagagccaggccgcg
gcggccgtggggcagatcgcacttgcgggcgcgtggtcgggcgagctcggccgccacggg
ctcatctccggccaggtgctggttacattgggtgatacggaagaacgccgccgctacctc
aacgcccgggcaacgatctcgacgcttctcaaaatgaaggccgttccagtcatcaatgag
aacgacaccgtggcgaccagcgaaatccgatacggggacaacgaccggttggctgcgcgc
gtcgccactatgatgggcggcgacctcctcatactcctgtccgatgtggatgggctttac
acggctccgcccgagcgcgatcctgcggcaaagttcatcccggtcgtggatgccatcacg
ccggaaattatggctatgggcggggctgccgcctcggagctatcccgagggggcatgcgc
accaagctcgatgccgggcggatcgccaccgcggcgggtacggcaatgatcatcgcatcg
gggaaggagcgcggcccgctgtccgcgatcgagcgcggcgcgcgcgctaccctcttcaag
ccgagccccacgccggttcgcgcctacaagacctggatcgcgggtcaactcgagcccgcc
ggccgtatcgggatcgatgacggcgcgttgagggcgctgcttcagggcaagagcctgcta
ccggcaggtgtgaggcgggtcgagggtgtcttctcccgtggcgacaccgtggcgatcgtt
gattccgcggggcgtgagattggccgggggctggttgcctatgatgccgccgatgccgta
aagatcgctgggctgaaaacgggcgatattgctggaatcctgggttacgaagcgcgagcg
gccatggtgcaccgggacgacctggtcctttccgggcctactggcgagctcatggatcgc
aaggtggaaggaatcgatgttgcaggtgcgtga

DBGET integrated database retrieval system