KEGG   Chelativorans sp. BNC1: Meso_3467Help
Entry
Meso_3467         CDS       T00374                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_3467
   01230 Biosynthesis of amino acids
    Meso_3467
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_3467
   00030 Pentose phosphate pathway
    Meso_3467
   00051 Fructose and mannose metabolism
    Meso_3467
   00052 Galactose metabolism
    Meso_3467
  Energy metabolism
   00680 Methane metabolism
    Meso_3467
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Meso_3467
Protein phosphatases and associated proteins [BR:mes01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Meso_3467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3742913..3744079
Genome map
AA seq 388 aa AA seqDB search
MAETFVIAQGGGPTAVINQTVAGIVMETRKLYPGARVLGARYGIRGIRDGNFVNLSDLPD
ETLLAMATTPSAALGSTRDKPDAAYCDAILEGLRNVGADAFINIGGNDTAGTQAILAEAS
GGSIAFIHAPKTIDNDLMENDHTPGFISAAEFVAGAFLSIDLDFRALPGIYVGIVMGRHA
GFLTAAASAWSLDEEGGPHLIYVPERPFERARFIEDVRAQISRHGRCIVAMSEGVSGSDG
RSLVEHIVPPETLERDQHGNVRLSGTDLGRAIEHMLAESLPGTRARVDTFGYLPRGNIAT
INEVDAQEAFEAGAFAVRAVERLGGSVALKYNDTETTCQLVPLVDVAGKTRQMPENFLHP
AENKVSGACRNYLSRLVPRKYRVARPFV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggccgagactttcgtcatcgcacaaggtggtggtcccactgccgttatcaaccagacc
gtggcgggcatcgtaatggaaacgcgaaagctttatcccggcgcacgggtgctcggcgcg
cgttatgggatacgtggcatccgtgacgggaatttcgttaacctgtccgatttgccggat
gaaaccctgctcgccatggccaccacgcccagtgccgccctcggcagcacgcgggataag
ccggatgcagcctattgcgacgcaatcctggaaggccttcgcaatgtcggcgcggacgcg
ttcattaatattggcggcaacgacacggcgggaacgcaggccatccttgccgaagcgtcg
ggcggcagcattgcctttattcatgctccaaagaccattgacaacgatttgatggagaac
gatcacacgcctggcttcatttccgcggcggagttcgtagctggagcgtttctgagcatc
gatctcgatttccgcgctttgcccggcatctatgttggtatcgtcatgggtagacatgcc
ggcttcctgacagccgccgcctctgcttggtctttggacgaagaaggcggccctcatcta
atttatgtgccggagcgccctttcgaacgcgctcgctttatcgaagacgtccgcgcgcaa
atctcgcgccacgggcgttgcatagtggcgatgtcggagggtgtttccggatcagacggc
cgatcccttgtcgagcacatcgttccacctgaaacgctggagcgagatcaacacggaaat
gttcgcctctccggcactgatcttgggagggccattgaacacatgctcgcagaaagccta
ccaggaacccgcgcgcgggtggatacgttcggttatctcccgcgtggaaacatcgccacg
attaacgaggtggatgcgcaggaagcattcgaggccggagcctttgctgtccgcgctgta
gagcggctgggtggttcagtcgcgttaaaatacaacgatacggaaaccacatgccagctg
gtgccgcttgtggacgtggccggaaagacgcggcaaatgcccgaaaatttccttcatcca
gcggaaaataaggtctctggtgcttgccggaactatctttccaggctggtgccccgcaaa
tacagggttgcacgaccattcgtgtag

DBGET integrated database retrieval system