KEGG   Chelativorans sp. BNC1: Meso_3570Help
Entry
Meso_3570         CDS       T00374                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Meso_3570
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Meso_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3842663..3843556
Genome map
AA seq 297 aa AA seqDB search
MITIIGSINLDLIARVERLPAPGETIPGSGFSTAPGGKGANQALAARRAGAQVRMIGAVG
ADSFADQALALLREAGVDLSRVKKPSPLTGVAMILVGADGENVIAVIPGANADVVEEDVE
AAGLSRDEFVLLQHEIPLPTIEAALRNARAAGAVSLLNAAPFQPQAADFLGLADYLVVNE
TEFDLYAQSLGLEGSDREQRARAYTARTGRTIVVTLGGDGVMAAAPDRFLRLPAFPITPV
DTVGAGDTFCGYLAAALSDGLVLEAALRRAAAAGALACLKPGAQPAIPFRSDVDSRL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccatcatcggttcaatcaatctcgatctcatcgcccgggtggagcggctgccc
gctccaggagagacaattcctggctccggcttttccacggcgccgggcggcaaaggcgcg
aatcaggcgctcgccgctcgacgcgccggcgcccaggtgcgcatgatcggcgcggtgggg
gcggattcgttcgcggatcaggcgctggcgctgcttcgtgaagccggcgtggacctttcg
cgcgtcaagaagccgtctccattgacaggggtcgcgatgatcttggtgggggccgatggg
gagaatgtgatcgctgtcatacccggcgcgaatgcggatgttgtggaagaagatgtcgaa
gcagcgggattgagccgtgatgagttcgtgcttcttcaacacgaaatccccttgccaacg
atagaagctgcacttcgcaacgcccgcgcagccggcgcggtctctctgctcaatgccgca
ccctttcagccgcaggcagcggattttctggggctggcggactatctcgtcgtcaacgag
accgaattcgatctctacgcccagtcgcttggtctggagggaagtgaccgcgaacaaagg
gcgcgtgcctacaccgccagaaccgggcggacgatcgtggtcactcttgggggtgatggt
gtcatggctgccgcgcccgaccggttcctgcgtcttcccgcatttcccatcacgccggtc
gacacggttggcgcgggcgataccttctgcggctatctcgcggccgcgctgtcggacggc
ctcgtgctcgaagctgcattacgccgcgcagcggcggccggggcccttgcctgcctgaag
cccggcgcgcaaccggctataccgtttcgctccgatgtagattcaaggttgtaa

DBGET integrated database retrieval system