KEGG   Chelativorans sp. BNC1: Meso_3594Help
Entry
Meso_3594         CDS       T00374                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_3594 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_3594 (glk)
   00052 Galactose metabolism
    Meso_3594 (glk)
   00500 Starch and sucrose metabolism
    Meso_3594 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Meso_3594 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Meso_3594 (glk)
   00524 Butirosin and neomycin biosynthesis
    Meso_3594 (glk)
Enzymes [BR:mes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Meso_3594 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3875989..3877017)
Genome map
AA seq 342 aa AA seqDB search
MAYSTDHDVVLDFPILIGDIGGTNARFAIVVDSYAEPREFPVVQTADFATIEDAIQTAIL
DQTHLIPRSAVLAVAGPVNGDEIDLTNSNWVVRPREMMAHLGFSDIVVLNDFEAQALAVV
ALGEEHLEKIGGNVAETVGSRVVLGPGTGLGVAGLVHARRTWIPVPGEGGHMDLGPRTAR
DEQIFPHLERIEGRVSGEQVLCGRGLVNLYRAIAKADAKEAAFSSPAEITTAGLAQADEI
AVETLNLFVTYLGRVAGDLGLVFMSRGGVFLTGGIAQKIVPALKNSLFRAAFEDKAPHNE
LMASMPVYVITHPLAALHGLAAYARTPARFGVETAGRRWRLR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattccaccgaccatgacgtggtgctcgatttcccgattttgatcggtgacatc
ggcggcaccaatgcgcgcttcgccattgtcgtggactcctatgccgagccgcgggaattt
cccgtcgtacagacggccgatttcgcaacgatagaggacgccatccagacggcgatcctt
gaccagacgcatctcattccgcgctccgccgtcctggcggttgcgggacccgtgaacgga
gacgaaatcgatctcaccaattcaaattgggtggtccggccgcgcgagatgatggcccat
ctgggtttcagcgatatcgtcgtactcaacgatttcgaggcgcaggcgctggctgtcgtg
gcgcttggggaagagcatctggaaaagattggcggcaacgtcgccgaaaccgtcgggagc
cgcgtcgtcctggggccggggaccggcctcggcgtggctggcctggtgcacgcgcgccga
acctggatccccgttccgggcgagggcggccatatggatcttggaccaaggacagcgcgc
gacgagcagatcttcccgcatctggagcggatcgaggggagggtttccggcgaacaggtg
ctttgcgggcgcggtctcgtcaacctctaccgtgcgatcgcaaaggcggatgccaaggag
gctgctttctcctcgcccgctgagattacgacggccgggctggcgcaggccgatgagatc
gcggttgagaccctgaacctcttcgtgacctatctcggcagggtcgcgggtgatctcggt
cttgtgttcatgagccggggcggagtgttcctgacaggaggcatcgcccagaagatcgtg
ccggcgctgaagaacagcctgttccgcgccgcctttgaagacaaggcgccgcacaatgaa
ctgatggcgtccatgccggtttatgtcatcacccatccgctggccgcgctgcacgggctt
gcggcctatgcccgaacgccagcgcgcttcggcgtcgaaacggcgggccggcgctggcgc
ttgcgctga

DBGET integrated database retrieval system