KEGG   Chelativorans sp. BNC1: Meso_3657Help
Entry
Meso_3657         CDS       T00374                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Meso_3657 (deoA)
Enzymes [BR:mes01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Meso_3657 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3948455..3949771
Genome map
AA seq 438 aa AA seqDB search
MPLPQEIIRRKRDGKALSPADIADFAAGLASGAWSEGQVAALAMAVLLNGMERDETVALT
LAMRDSGDVLDWLSLPAPVTDKHSTGGVGDNVSLMLAPIVAACGAYVPMISGRGLGHTGG
TLDKMDSIPGYRSQPTREEFERTVRAAGCAIIGQTGDLAPADRRFYAIRDVTGTVESIPL
ITASILSKKLAAGLQSLVLDVKSGNGAFMAERSEAQALATSLVQVAQGAGLSASALITDM
NEPLATAAGNAVEVRNAVDFLTGETRDERLEEVTLALAAEMLVATGIASGGENALKRART
ALESGGAAERFSRMVAALGGPADFVEKMDQYLPRAPETRAVKAERAGFVASIDTRALGIV
VVELGGGRRRPEDPIDHAVGLTATLPIGREVRRDDPLAVVHARTPADAERAAEAVRRAYR
IADERLSTQSPVLEKIAG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcccccaggaaatcatccgcaggaaacgcgacggcaaggctctgtcgccggcc
gatatcgctgattttgcggccggtcttgcctccggcgcctggagcgaagggcaggtggcc
gccctcgccatggcggtcctgctcaacggcatggagcgcgatgaaaccgtcgcgctcact
cttgcaatgcgcgattccggcgacgtgctcgactggttgtcacttcccgccccggtcacc
gacaagcattccacgggcggcgtgggcgataatgtctcgctgatgctggcgcccatcgtc
gccgcctgcggcgcctatgtgcccatgatatcggggcgcgggctcgggcatacgggcggc
acgctcgacaagatggactccattcccggctatcgcagccagccgacgcgggaagagttc
gagcgaaccgtgcgcgccgccggctgcgccatcatcggccagacgggagaccttgcgccc
gcggaccgccgcttctacgccatcagagacgtgaccggcacggtggaatccatccctctc
atcacggcgtcgattctttccaaaaaacttgccgccggcctgcagtcgttggtcctcgac
gtaaaatcgggcaacggcgccttcatggccgagaggagcgaggctcaggcgctcgcgacc
agcctcgtgcaggtggcgcagggcgcggggctatctgccagcgcgcttatcacggacatg
aacgagccgctcgccacggccgcgggcaatgctgtcgaggtgcgaaacgccgtcgatttt
ctcacgggagaaacacgggatgagcgccttgaggaggtgacgctggcgctggcggccgag
atgctcgtagccacgggcatcgcatccggtggggagaatgcgttgaaacgcgcccgcacg
gcgctcgaaagcggcggtgcggccgagcgctttagccggatggtcgccgcgcttggcggc
cccgccgatttcgttgagaagatggaccaatatctccctcgcgcgcccgaaacgcgtgct
gtgaaagccgagcgggcgggattcgtcgccagcatagacacgcgggcgctgggaattgtc
gtggtcgaactcggcggcggccggcgcaggccggaagatccaatcgaccacgccgtcggc
ctcacagccacattgcccatcggcagggaagtccgccgcgacgatccgctggccgtggtc
catgcccgcacgcccgccgatgccgaacgggcagccgaagcggtccgccgcgcctaccgc
atcgccgatgagcggctttccacgcaatcgcctgtgctggagaagatcgcgggctga

DBGET integrated database retrieval system