KEGG   Chelativorans sp. BNC1: Meso_3880Help
Entry
Meso_3880         CDS       T00374                                 

Definition
(GenBank) putative thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mes  Chelativorans sp. BNC1
Pathway
mes00240  Pyrimidine metabolism
mes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Meso_3880
Enzymes [BR:mes01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Meso_3880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C DUF2254
Motif
Other DBs
NCBI-ProteinID: ABG65247
JGI: Meso3880
UniProt: Q11BH8
Position
4181419..4182948
Genome map
AA seq 509 aa AA seqDB search
MTALVSPAGPEQPSLRVRRLLLHTQHQPVVVMHTDCHVCRSEGLAARSQVLLTNGARQVH
ATLFQVDGDAVLSHDEVGLSETAWDLLGVAEGDEVRVSHPPALESLASVRRRIYGHRLDA
QALSEIVRDVAAGRYTDVHLAAFLTASAALPLDENETADLTGAMIAVGDRMEWDAPTVVD
KHCVGGLPGNRTTPIVVAIVAANGLVMPKTSSRAITSPAGTADTMETLAPVDLDLATLRR
VVEAEGGCIAWGGAVHLSPADDIFVRVERELDVDTEGQLIASVLSKKISAGSTHVVIDIP
VGPTAKVRGEDAASHLASRITAVASRFGLAATCVQTDGSQPVGRGIGPALEAFDVLAVLQ
NASDAPDDLRRRAATLAGAALEIGRKAGKGEGTALALETLADGRAWKKFEAICEAQGGLR
APPRAAHVHPLVAPRAGRVVHINNRKLSRLAKLAGAPESKAGGVHMDVRLGDEIDRGQPL
LHVHAETTGELAYALDYAARAGDIVEIEA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctcgtctctcccgccggtcccgagcagccatctctccgcgttcgacgcctg
ctgttgcacacccagcaccagccggtcgtcgtcatgcacacggactgtcacgtctgcagg
tcggaagggttggcggcacgttcgcaggttctcctcaccaacggagcccggcaggtgcat
gcgacgctgtttcaggtcgacggcgacgccgtgctcagccacgacgaggtcggtctctcg
gaaacggcctgggacctcctcggcgtcgcggaaggcgacgaggtccgggtcagccacccg
cccgcgctggaatcgctcgcaagcgtgcggcgccgcatctatggccaccgcctcgatgcc
caggccctgtccgagatcgtaagggacgtcgccgccggtcgctacaccgacgtccacctg
gccgcctttctgaccgcgagcgcggcgctgcctctcgacgagaacgagaccgccgatctg
accggcgccatgatcgcggtcggtgacaggatggaatgggacgctcccaccgtcgtcgac
aagcactgtgtcggcggcttgcccggaaatcgcaccacgcccatcgtcgtggcgatcgtc
gcggccaatgggctcgtaatgcccaagacctcctcgcgcgccatcacctcgccggccggc
accgccgacacgatggagacgctggccccggtcgatctcgatcttgccacgctgaggcgt
gtcgtcgaggcggaaggcggatgcatcgcctggggcggcgccgtccatctgagcccggcc
gacgacatcttcgtgcgggtcgagcgcgagctcgacgtcgacaccgagggtcagctcatc
gcctcggtgctttccaagaagatctccgccggctccacccatgtcgtcatcgacattccg
gtgggtcccacggcgaaggttcgcggagaagatgcggcatctcatctcgcctcccggata
acggcggtcgcgtcccgcttcggcctcgcggccacatgcgtgcagaccgatggatcccag
ccggtcggccgcggcatcggtcccgctctcgaggcgttcgacgtgcttgccgtgctgcaa
aatgcgtccgacgccccggacgatctgcgccggcgcgccgccacgttggccggcgcggcc
ctggagatcggacgcaaggccggcaagggagaaggaaccgcgctcgcgctggagacgctt
gccgatggtcgggcatggaagaagttcgaggcgatctgcgaggcgcagggcgggctgcgc
gcaccccccagggcggctcatgtccatccgcttgtcgctccgcgcgccggacgggtggtt
catatcaacaatcgtaagctgtcacgcctcgccaagctcgcaggcgctccggaatcgaag
gcggggggcgtccatatggacgttcggctcggcgacgaaatcgatcgcgggcaacccctg
ctccatgtccatgccgagacaacgggcgagcttgcctacgcgctcgactatgccgcgcgc
gccggggatattgtcgagatcgaggcttga

DBGET integrated database retrieval system