KEGG   Chelativorans sp. BNC1: Meso_3880Help
Entry
Meso_3880         CDS       T00374                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mes00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4181419..4182948
Genome map
AA seq 509 aa AA seqDB search
MTALVSPAGPEQPSLRVRRLLLHTQHQPVVVMHTDCHVCRSEGLAARSQVLLTNGARQVH
ATLFQVDGDAVLSHDEVGLSETAWDLLGVAEGDEVRVSHPPALESLASVRRRIYGHRLDA
QALSEIVRDVAAGRYTDVHLAAFLTASAALPLDENETADLTGAMIAVGDRMEWDAPTVVD
KHCVGGLPGNRTTPIVVAIVAANGLVMPKTSSRAITSPAGTADTMETLAPVDLDLATLRR
VVEAEGGCIAWGGAVHLSPADDIFVRVERELDVDTEGQLIASVLSKKISAGSTHVVIDIP
VGPTAKVRGEDAASHLASRITAVASRFGLAATCVQTDGSQPVGRGIGPALEAFDVLAVLQ
NASDAPDDLRRRAATLAGAALEIGRKAGKGEGTALALETLADGRAWKKFEAICEAQGGLR
APPRAAHVHPLVAPRAGRVVHINNRKLSRLAKLAGAPESKAGGVHMDVRLGDEIDRGQPL
LHVHAETTGELAYALDYAARAGDIVEIEA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctcgtctctcccgccggtcccgagcagccatctctccgcgttcgacgcctg
ctgttgcacacccagcaccagccggtcgtcgtcatgcacacggactgtcacgtctgcagg
tcggaagggttggcggcacgttcgcaggttctcctcaccaacggagcccggcaggtgcat
gcgacgctgtttcaggtcgacggcgacgccgtgctcagccacgacgaggtcggtctctcg
gaaacggcctgggacctcctcggcgtcgcggaaggcgacgaggtccgggtcagccacccg
cccgcgctggaatcgctcgcaagcgtgcggcgccgcatctatggccaccgcctcgatgcc
caggccctgtccgagatcgtaagggacgtcgccgccggtcgctacaccgacgtccacctg
gccgcctttctgaccgcgagcgcggcgctgcctctcgacgagaacgagaccgccgatctg
accggcgccatgatcgcggtcggtgacaggatggaatgggacgctcccaccgtcgtcgac
aagcactgtgtcggcggcttgcccggaaatcgcaccacgcccatcgtcgtggcgatcgtc
gcggccaatgggctcgtaatgcccaagacctcctcgcgcgccatcacctcgccggccggc
accgccgacacgatggagacgctggccccggtcgatctcgatcttgccacgctgaggcgt
gtcgtcgaggcggaaggcggatgcatcgcctggggcggcgccgtccatctgagcccggcc
gacgacatcttcgtgcgggtcgagcgcgagctcgacgtcgacaccgagggtcagctcatc
gcctcggtgctttccaagaagatctccgccggctccacccatgtcgtcatcgacattccg
gtgggtcccacggcgaaggttcgcggagaagatgcggcatctcatctcgcctcccggata
acggcggtcgcgtcccgcttcggcctcgcggccacatgcgtgcagaccgatggatcccag
ccggtcggccgcggcatcggtcccgctctcgaggcgttcgacgtgcttgccgtgctgcaa
aatgcgtccgacgccccggacgatctgcgccggcgcgccgccacgttggccggcgcggcc
ctggagatcggacgcaaggccggcaagggagaaggaaccgcgctcgcgctggagacgctt
gccgatggtcgggcatggaagaagttcgaggcgatctgcgaggcgcagggcgggctgcgc
gcaccccccagggcggctcatgtccatccgcttgtcgctccgcgcgccggacgggtggtt
catatcaacaatcgtaagctgtcacgcctcgccaagctcgcaggcgctccggaatcgaag
gcggggggcgtccatatggacgttcggctcggcgacgaaatcgatcgcgggcaacccctg
ctccatgtccatgccgagacaacgggcgagcttgcctacgcgctcgactatgccgcgcgc
gccggggatattgtcgagatcgaggcttga

DBGET integrated database retrieval system