KEGG   Chelativorans sp. BNC1: Meso_3915Help
Entry
Meso_3915         CDS       T00374                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_3915
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Meso_3915
   00630 Glyoxylate and dicarboxylate metabolism
    Meso_3915
Enzymes [BR:mes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Meso_3915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4216458..4218656
Genome map
AA seq 732 aa AA seqDB search
MTDRVEINGLKIARELHDFAMNEVLPGTGVDAETFWHSLSQIVHTLSPRNRALLSKRDDL
QAKIDAWHRANRAPSDLQAYEAFLREIGYLLPEGPDFKVTTSDVDPEISQIAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETAGAERGKGFNPQRGEKVIAWARKFLDESIP
LRNASWADAARLSVKDGKLAVDFDGAAADLADPAQFTGYSGEADSPREVVLARNGLHVRI
IIDRNHPIGSTDRAGIADVVMEAALTTIMDCEDSVAAVDAEDKVLAYRNWLGLMKGDLEE
TFQKGGTTVTRKLNQDIRLTAPDGSPIKLPGRSLMLVRNVGHLMTNPAILDRDGKEVPEG
IMDAMFTALIALHDIGPNGRRMNSRAGSMYVVKPKMHGPEEVAFAVELFGSVEDALGMRP
NTIKMGIMDEERRTTVNLKECIRAASERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QSTWIAAYENWNVDIGLLCGLSGRAQIGKGMWAMPDLMAAMLDQKIAHPKAGANTAWVPS
PTAATLHATHYHQVDVKAVQEGLKSRTRAKLGDILSIPVAVRPNWSPEDIRQELDNNAQG
ILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLHHGVVTPEQVMETMKR
MAEVVDSQNAGDPDYEPIAPNFEDSIAFQAACDLVFKGREQPNGYTEPVLHARRLQKKAQ
DRKGAAADSSRG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcgtcgagatcaacgggctcaagatcgcccgtgagcttcatgactttgcg
atgaacgaagtccttccggggactggtgtggatgcagagaccttctggcattcactttcc
caaatcgttcacacgctctcgccgcgcaaccgcgcgctgctttccaaaagggatgacctg
caggcgaagatcgatgcctggcatcgcgcgaatcgcgcgccgagtgacctgcaggcctat
gaggcctttctccgggagatcggctatctcctgcctgaggggccggatttcaaggtgacg
acttcggatgtcgacccggagatctcgcagattgccgggccgcagctcgtcgtgccggtg
atgaacgcgcgctatgcgctcaatgccgcgaatgcacgctggggttcgctctacgatgct
ctttacgggaccgacgccattcccgaaacggcaggcgcggagcgcggcaaagggttcaat
ccgcagcggggcgagaaggttattgcctgggcgcgcaagttcctggacgagagcataccg
ctaagaaatgcgagctgggccgatgcggcgcggctttctgtgaaggacgggaagctagct
gtcgatttcgacggcgccgccgctgacctggcggacccggcgcagttcaccggttatagc
ggagaggctgatagtccccgcgaagtggtgttggcccgaaacgggctccatgtgcgaatc
atcatagatcgcaaccatccgatcggcagcaccgacagggcaggtattgccgacgtcgtc
atggaagccgcactcacaacaatcatggattgcgaggattccgtcgcggccgtcgatgcg
gaagacaaggtgctcgcctaccgcaattggctaggcctcatgaagggggatcttgaggag
acgttccagaagggcggcacaacggtcacgcggaagctcaatcaggatatccgcctcact
gcgcccgacggttcgccgattaagcttcccggccgttcactcatgctcgtccgcaatgtc
ggccacctcatgacaaacccggcgatcctcgacagggatggcaaggaggtgcccgagggc
atcatggatgcaatgttcacggcgttgatcgcgctgcacgacattggtccaaacggccgg
cgcatgaacagccgtgccggctccatgtatgtggtaaagccgaaaatgcacgggccggag
gaagtcgcgtttgccgtggagctcttcggcagcgtggaggatgcgctgggcatgcgcccc
aatacgatcaagatgggcatcatggacgaggagcggcgcacgaccgtgaaccttaaggag
tgcatccgagccgcttcggagcgcgtagtgttcatcaataccggtttcctcgaccgcacg
ggcgacgagatccatacctcgatggaagccggcccaatgatccgcaagggcgatatgaag
cagtcgacctggatagcggcttacgagaactggaatgtcgatatcgggctcctgtgcgga
ctttctggccgtgcccagatcggcaagggcatgtgggcgatgcccgatctgatggcggcc
atgctggaccagaagatcgcccatccgaaggcgggcgccaatacggcttgggtcccttcg
ccaaccgcggccacgctgcacgcgacccattaccaccaggtggacgtaaaggcggtgcag
gaaggcctgaaatcccgcacaagggccaagctcggcgatatcctctccattccagtggcg
gtgcgcccgaactggtcgcctgaagatatcaggcaggagctcgacaacaacgcccaggga
attctcggctatgttgtgcgctggatcgatcagggcgtgggctgctccaaggtgccggac
atcaataatgtgggcctgatggaagaccgcgcgacactgcgcatctcctcccagcacatc
gccaattggctgcatcacggcgtggttacgccggagcaggtgatggaaaccatgaagcga
atggcggaggtggtcgacagtcagaatgcaggtgatcccgactacgaaccgatagcgccg
aattttgaggattccatcgcctttcaggctgcctgtgacctcgtctttaagggccgcgag
cagccaaacggctatacggagccggtgctgcatgcaaggcggctccagaagaaggctcaa
gacaggaagggtgctgcggctgacagctccagaggctga

DBGET integrated database retrieval system