KEGG   Chelativorans sp. BNC1: Meso_3915Help
Entry
Meso_3915         CDS       T00374                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_3915
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Meso_3915
   00630 Glyoxylate and dicarboxylate metabolism
    Meso_3915
Enzymes [BR:mes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Meso_3915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4216458..4218656
Genome map
AA seq 732 aa AA seqDB search
MTDRVEINGLKIARELHDFAMNEVLPGTGVDAETFWHSLSQIVHTLSPRNRALLSKRDDL
QAKIDAWHRANRAPSDLQAYEAFLREIGYLLPEGPDFKVTTSDVDPEISQIAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETAGAERGKGFNPQRGEKVIAWARKFLDESIP
LRNASWADAARLSVKDGKLAVDFDGAAADLADPAQFTGYSGEADSPREVVLARNGLHVRI
IIDRNHPIGSTDRAGIADVVMEAALTTIMDCEDSVAAVDAEDKVLAYRNWLGLMKGDLEE
TFQKGGTTVTRKLNQDIRLTAPDGSPIKLPGRSLMLVRNVGHLMTNPAILDRDGKEVPEG
IMDAMFTALIALHDIGPNGRRMNSRAGSMYVVKPKMHGPEEVAFAVELFGSVEDALGMRP
NTIKMGIMDEERRTTVNLKECIRAASERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QSTWIAAYENWNVDIGLLCGLSGRAQIGKGMWAMPDLMAAMLDQKIAHPKAGANTAWVPS
PTAATLHATHYHQVDVKAVQEGLKSRTRAKLGDILSIPVAVRPNWSPEDIRQELDNNAQG
ILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLHHGVVTPEQVMETMKR
MAEVVDSQNAGDPDYEPIAPNFEDSIAFQAACDLVFKGREQPNGYTEPVLHARRLQKKAQ
DRKGAAADSSRG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcgtcgagatcaacgggctcaagatcgcccgtgagcttcatgactttgcg
atgaacgaagtccttccggggactggtgtggatgcagagaccttctggcattcactttcc
caaatcgttcacacgctctcgccgcgcaaccgcgcgctgctttccaaaagggatgacctg
caggcgaagatcgatgcctggcatcgcgcgaatcgcgcgccgagtgacctgcaggcctat
gaggcctttctccgggagatcggctatctcctgcctgaggggccggatttcaaggtgacg
acttcggatgtcgacccggagatctcgcagattgccgggccgcagctcgtcgtgccggtg
atgaacgcgcgctatgcgctcaatgccgcgaatgcacgctggggttcgctctacgatgct
ctttacgggaccgacgccattcccgaaacggcaggcgcggagcgcggcaaagggttcaat
ccgcagcggggcgagaaggttattgcctgggcgcgcaagttcctggacgagagcataccg
ctaagaaatgcgagctgggccgatgcggcgcggctttctgtgaaggacgggaagctagct
gtcgatttcgacggcgccgccgctgacctggcggacccggcgcagttcaccggttatagc
ggagaggctgatagtccccgcgaagtggtgttggcccgaaacgggctccatgtgcgaatc
atcatagatcgcaaccatccgatcggcagcaccgacagggcaggtattgccgacgtcgtc
atggaagccgcactcacaacaatcatggattgcgaggattccgtcgcggccgtcgatgcg
gaagacaaggtgctcgcctaccgcaattggctaggcctcatgaagggggatcttgaggag
acgttccagaagggcggcacaacggtcacgcggaagctcaatcaggatatccgcctcact
gcgcccgacggttcgccgattaagcttcccggccgttcactcatgctcgtccgcaatgtc
ggccacctcatgacaaacccggcgatcctcgacagggatggcaaggaggtgcccgagggc
atcatggatgcaatgttcacggcgttgatcgcgctgcacgacattggtccaaacggccgg
cgcatgaacagccgtgccggctccatgtatgtggtaaagccgaaaatgcacgggccggag
gaagtcgcgtttgccgtggagctcttcggcagcgtggaggatgcgctgggcatgcgcccc
aatacgatcaagatgggcatcatggacgaggagcggcgcacgaccgtgaaccttaaggag
tgcatccgagccgcttcggagcgcgtagtgttcatcaataccggtttcctcgaccgcacg
ggcgacgagatccatacctcgatggaagccggcccaatgatccgcaagggcgatatgaag
cagtcgacctggatagcggcttacgagaactggaatgtcgatatcgggctcctgtgcgga
ctttctggccgtgcccagatcggcaagggcatgtgggcgatgcccgatctgatggcggcc
atgctggaccagaagatcgcccatccgaaggcgggcgccaatacggcttgggtcccttcg
ccaaccgcggccacgctgcacgcgacccattaccaccaggtggacgtaaaggcggtgcag
gaaggcctgaaatcccgcacaagggccaagctcggcgatatcctctccattccagtggcg
gtgcgcccgaactggtcgcctgaagatatcaggcaggagctcgacaacaacgcccaggga
attctcggctatgttgtgcgctggatcgatcagggcgtgggctgctccaaggtgccggac
atcaataatgtgggcctgatggaagaccgcgcgacactgcgcatctcctcccagcacatc
gccaattggctgcatcacggcgtggttacgccggagcaggtgatggaaaccatgaagcga
atggcggaggtggtcgacagtcagaatgcaggtgatcccgactacgaaccgatagcgccg
aattttgaggattccatcgcctttcaggctgcctgtgacctcgtctttaagggccgcgag
cagccaaacggctatacggagccggtgctgcatgcaaggcggctccagaagaaggctcaa
gacaggaagggtgctgcggctgacagctccagaggctga

DBGET integrated database retrieval system