KEGG   Chelativorans sp. BNC1: Meso_3963Help
Entry
Meso_3963         CDS       T00374                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mes01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mes00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4267192..4268121)
Genome map
AA seq 309 aa AA seqDB search
MRCKILGAPVQDGAGCRGCDMGPSALRVAGLVEALSELGHTVEDLGNVSPKLQSPLAHPN
SVLRSLSEIAGWTAALAEAAYRASADALPIFLGGDHSISAGTVSGIAQRAAELRRPLFVL
WLDAHTDFHTLDSTVSGNLHGVPLAYATGQPGFDGYFPPLMAAVDPFRTCVMGIRSIDPA
ERIAINEAGVTMYDMRAIDEHGVAPLLRAFLERVASQDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLVMEMLHDSGLVSSLDLVELNPFLDERGRTATLMVDLASSLMGRRIMD
RPTRSYSHG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcaaaatcctgggggcacccgttcaagacggtgcagggtgcagaggatgcgac
atgggcccgagcgcgcttcgcgtcgcgggattggtcgaagcattgagcgagcttggccac
acagtcgaggatctgggcaatgtgagccccaagcttcagtctccacttgcccatccgaac
tcagtcctcaggtcattatccgagatcgccggctggaccgccgctcttgcagaggcggcc
tatcgcgccagcgccgacgcgctgcccatctttctcggcggcgaccacagcatatccgct
ggaacggtttccggcatcgctcaacgggctgcagaactcaggcgtccgcttttcgtgtta
tggctcgatgcgcacaccgatttccacacgctggacagcacggtgagcggcaaccttcat
ggggtgccgctggcctatgccaccggacaaccgggcttcgacggctatttccctccgcta
atggccgccgtcgatccattccgcacctgcgtaatgggcatccgcagtatcgatcccgct
gaacgtatcgccatcaatgaggcgggcgtgaccatgtacgatatgcgcgccatcgacgag
cacggcgttgcgccgcttctgcgcgcttttctggagcgggtcgcctcgcaggacggactg
ctgcatgtcagcctggacgtcgacttcctcgatccctcgatcgcgccggcggtcggcacc
accgtgccgggcggagcgacctttcgcgaggcacatctggtgatggaaatgctgcacgat
agcggcctcgtcagcagtctggacctggtcgagctcaatccctttctcgatgaacgtggc
cgcacggcaaccctgatggtcgatctggcctccagcctgatgggacgccgcattatggac
cggccgacgcggagctactcacatggataa

DBGET integrated database retrieval system