KEGG   Chelativorans sp. BNC1: Meso_4085Help
Entry
Meso_4085         CDS       T00374                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
mes  Chelativorans sp. BNC1
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mes00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mes02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4396789..4397649)
Genome map
AA seq 286 aa AA seqDB search
MPAEDTEKGALGHMDSFELNKFIGAFLGVVFVVFSISLLSDAVFSSPEPETPGYAIAVPE
GGATEGGGEAQPAAESVLPLLASADASAGEAVFKRCGACHTVEQGGPNKVGPNLWSVVDR
PIASHEGFSYSSALTEFSEGGQKLWTYENLDHFLASPKGLVPGTAMSFAGLSKVEDRANL
IAYLRTMSDQPVPLPEAAPAGEEGAAAPAEGGEQTPPAEGEAAPPAEGAAPAEGTAAPAQ
DGAAPAEGAPAGDTQAPAQTEETTTPPATEGEAGGSTGETQPAPAQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggaggatacggagaagggggccttagggcacatggattctttcgaactcaac
aaattcatcggcgcattcctcggcgttgttttcgtggtattctccattagcctattgtcc
gatgccgtcttttcctctcccgagccggaaacacccggttatgccatcgcggtacccgaa
ggcggcgctaccgaaggcggcggagaggcccaaccggctgccgaatcagtgctgccgctt
cttgcctctgccgacgcttcggcaggtgaggccgttttcaagcgctgcggagcctgccat
acggtcgagcagggcggcccgaacaaggtgggccccaatctgtggagtgtcgttgaccgc
ccgatcgcgagtcatgagggcttcagctattcgagcgcgttgacggagttctcggaaggc
ggccagaagctctggacttatgagaatctggaccacttcctggccagccccaagggcctc
gttccgggcacggccatgtccttcgcgggcctcagcaaggtggaggatcgggccaacctg
atcgcctatctgcgcacgatgtcggaccagcctgttccgctgccggaagcagcgcccgcg
ggtgaagaaggtgccgccgcgcccgcggaaggcggcgagcagacgccgcctgcggagggc
gaggcagcccccccggccgagggtgccgctccggcggaaggaacggcagcgccagcccaa
gacggtgctgcgcccgcggaaggcgcgcctgccggggatacacaggctccggcccagacg
gaagaaaccactacgcccccagctacggaaggcgaagctggcggcagcacaggcgaaacg
cagcccgctcccgctcaatag

DBGET integrated database retrieval system