KEGG   Chelativorans sp. BNC1: Meso_4100Help
Entry
Meso_4100         CDS       T00374                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mes  Chelativorans sp. BNC1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mes03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4409575..4410468
Genome map
AA seq 297 aa AA seqDB search
MPELPEVETVRRGLEPVMEGARIIHVEQRRADLRFPFPAGFSEHVKGCRIEALGRRAKYL
LLHLENGRVLVSHLGMSGSFRIEESGSDKLRGDFHYARSKAEKHDHVVFHLARHEGGSAR
VIYNDPRRFGFMLLLDSADLEAHPLFAGLGVEPTGNALDGALLARLLAGKRAPLKAALMD
QRLVAGLGNIYVCEALWRAGLSPRRIAATIATREGKSTGRSERLAGAIRTVIAEAIAAGG
SSLKDYVQADGSLGYFQHSFSVYDREGKPCRKEGCSGTIQRFVQGGRSTFYCPICQR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttccagaggtcgaaacagtccggcgtggcctggagcctgtgatggaaggc
gcgcggataatccacgtcgagcagcgccgcgccgatctgcgctttccctttcccgccggc
ttttccgaacacgtgaaaggatgcaggatcgaggctctcgggcgccgcgcaaaatatctg
cttctccacctggaaaacggcagggtgctcgtaagccatttgggcatgtccggctctttt
cgcatcgaggagagcgggtcggacaagcttcgcggtgacttccattacgcgcgttcaaag
gccgagaagcacgaccatgtcgtcttccacctggcgcggcacgaaggcggctcggcccgc
gtcatctacaatgatccgcggcgcttcggcttcatgcttctcctggacagcgcggatctg
gaagcgcacccgctttttgccgggctcggcgtcgaacccaccggcaatgcgcttgacggc
gcgcttctggcccggctgcttgccggaaagcgtgccccgctcaaggctgcgctcatggac
cagcggttggtggctggccttggcaacatctatgtatgcgaggcgctttggcgcgcgggt
ctttcaccgcgccgtatcgccgctacgatcgcgacacgcgagggcaaatcgacgggacgc
agcgagcgtttggctggggcgatccgcacggttattgccgaggccatcgcggcgggaggc
tcatccctcaaggattatgtccaggcagacggctcgctcggctattttcaacatagcttc
agcgtctatgatcgcgaggggaagccctgccgcaaggaaggttgttcaggcacgatccag
cggttcgtgcagggaggccgctctacattctattgccctatatgtcagcgctag

DBGET integrated database retrieval system