KEGG   Methylobacterium sp. 4-46: M446_0105Help
Entry
M446_0105         CDS       T00679                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
met  Methylobacterium sp. 4-46
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M446_0105
Enzymes [BR:met01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     M446_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(122895..124076)
Genome map
AA seq 393 aa AA seqDB search
MRSFLRLAATILILGSAALGGARPGLAQQPGAAEPPPRARDAKNRDGESRTGENRTGEPA
SLHNALGNGAAWRAYKARFVTDQGRVVDTANGRISHSEGQGYGMLLAVAAGDRDAFQRIW
DWTRANLMVRDDSLLAWRWEPDKRPGVADMNNATDGDLLVAWALIEAADAWQDEGYRLAA
RRIAVDIGRRTVLFRSEGAALLLPGMAGFSAEDRADGPVINLSYWIFPALARLPAVAPEF
DWARLSAAGLDLALRARFGEAALPVEWTSLRGGEPKAAAGFPPVFSYNAVRVPLYLAMAG
IAERRYYAPFVKAWAEVGASGLPVVDTASNDVVGRMQEPGYLAVAALTACAAGTASLPPA
LPDPTSPQNYYPATLQLLALAAVNMRYASCLGR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagatccttcctgcgcctcgcggcgacgatcctgatcctgggcagcgccgcgctgggc
ggcgcccggccaggcctcgcccagcagccgggcgccgccgagccgccgccccgcgcgcgc
gacgccaagaaccgtgatggcgagagccggactggcgagaaccggactggcgagccggcg
tcgctccacaacgccctcggcaacggggcggcgtggcgcgcctacaaggcgcgcttcgtc
accgaccagggccgcgtcgtcgacacggccaacggccgcatcagccacagcgaggggcag
ggctacggcatgctgctcgccgtcgcggccggggaccgcgacgccttccagcggatctgg
gactggacccgcgccaacctcatggtccgggacgattccctgctggcctggcgctgggag
ccggacaagcgcccgggcgtcgccgacatgaacaacgccaccgacggcgacctcctggtg
gcctgggccctcatcgaggccgcggacgcctggcaggacgagggctaccgcctcgcggca
cggcgcatcgccgtcgatatcggccgccgcacggtgctgttccgctccgagggcgcggcc
ctgctcctgccgggcatggccgggttctcggccgaggaccgggcggatgggccggtgatc
aacctgtcctactggatcttccccgccctggcgcgcctgcccgcggtggcgcccgaattc
gactgggcccggctcagcgcggccggcctcgacctcgcgctgcgggcgcggttcggggag
gcggcgctgccggtcgagtggacctcgctgcgcgggggcgagccgaaagcggcggccggc
ttccccccggtcttctcctacaacgcggtccgggtgccgctctacctcgccatggcgggc
atcgcggagcgccgctactacgcccccttcgtgaaggcctgggccgaggtcggcgcctcg
ggcctgccggtggtcgacaccgcgagcaacgacgtcgtcggacggatgcaggagcccggc
tacctcgcggtcgcggccctcaccgcctgcgcggccggcacggcctcgctgccgcccgcc
cttcccgacccgacctcgccgcagaactactacccggcgacgctccagctcctggccctc
gccgccgtcaacatgaggtacgcgtcatgccttgggcgctga

DBGET integrated database retrieval system