KEGG   Methylobacterium sp. 4-46: M446_0411Help
Entry
M446_0411         CDS       T00679                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:met00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
495304..496305
Genome map
AA seq 333 aa AA seqDB search
MTVPLIATPDNPIPPGARTLAVPTRDGLTLRAATWTAATRTTKGTVCLVQGRAEFIEKYY
ETVQDLRARGFAVAAFDWRGQGGSDRTVADARKGHVGDFEEYRLDLEAVATQVLEPLMPR
PYFGLAHSMGGAVCLAAAREGWLPFSRLVTLAPMLGIVMVRHPRAAMRAAALLNGLGLGP
RFVPGGSPVSIATKPFPGNRLTTDPARYARNAAAALAVGAGAVGDPTVAWLAAAFRTMRR
LGDPRYPLAIRLPVLVVAAGDDPVCSTPAIERFAARLKAGHSITLRGARHEILMEQDAIR
AQFWAAFEAFVPGTPLPEPREEDLIALERLPPG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttccgctcatcgccacgccggacaacccgatcccgcccggcgcccgcaccctc
gcggtgccgacccgggacgggctgaccctgcgggccgcgacctggacggcggccacccgc
accaccaagggcaccgtctgcctggtgcagggccgggccgagttcatcgagaagtactac
gagacggtccaggacctgcgggcgcggggcttcgccgtggcggccttcgactggcgcggc
cagggcggctccgaccgcaccgtcgcggacgcgcgcaagggccatgtcggcgatttcgag
gagtaccggctcgacctggaggcggtcgccacgcaggtgctggagccgctgatgccgcgg
ccctatttcgggctcgcccactcgatgggcggggcggtctgcctggccgcggcgcgggag
ggatggctgcccttctcccgcctcgtcacgctcgcgccgatgctcggcatcgtgatggtg
cgccacccgcgggccgcgatgcgggcggccgccctcctcaacgggctcggcctcggcccg
cgcttcgtcccgggcggcagcccggtctcgatcgccacgaagcccttccccggcaatcgc
ctcaccaccgatccggcgcgctacgcccgcaacgcggcggcggcgctcgcggtcggggcc
ggcgcggtcggggatccgaccgtggcctggctcgccgccgccttccggacgatgcgccgc
ctcggcgacccgcgctacccgctcgcgatccggctgcccgtgctggtggtggcggcgggc
gacgacccggtctgcagcacgcccgccatcgagcgcttcgcggcgaggctcaaggccggc
cacagcatcaccctgcggggcgcccggcacgagatcctgatggagcaggacgcgatccgg
gcccagttctgggccgccttcgaggccttcgtcccgggcacgccgctcccggagccgcgc
gaggaggacctcatcgcgctcgagcggctgccgcccggctaa

DBGET integrated database retrieval system