KEGG   Methylobacterium sp. 4-46: M446_0636Help
Entry
M446_0636         CDS       T00679                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
met  Methylobacterium sp. 4-46
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M446_0636
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     M446_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
738833..739993
Genome map
AA seq 386 aa AA seqDB search
MTRTVTVLGATGSIGRSTADLLDQHRDRFRVAAVAGGRDAASLARVARALGAEFAALADP
EGGPALRDALGGSGIACGAGPEAVVEAASREADLVVAAVSGAAGLGPTHAAIRLGRTVAL
ANKESLVCAGDAFMRDARRYGARILPMDSEHNALAQAIGEGKVEDITRMTITASGGPFRT
APRETIAAASAAQAAAHPTWSMGMKINIDSATLMNKGLELVEAHHLFAIEAERLDVVVHP
QSIVHGLVTWRDGAVTAGLAMPDMRVPIAHCLGIGERLTVARGRPVDLAATGSLTFERPD
EERFPCLRIAKAALATGGAQPTVMNAANEIAVAAFIAGRIGFYDIAALVERACAAFAARF
PAAPADVGEALAMDDEVRRWSAQALG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcgcaccgtcaccgtgctcggggcgaccggctccatcgggcgctccaccgccgac
ctcctcgaccagcaccgcgaccgcttccgggtcgccgcggtggcggggggcagggacgcc
gcctccctggcccgcgtcgcccgcgcgctcggggccgagttcgcggccctcgccgatccg
gagggcgggccggccctgcgggacgccctcgggggcagcggcatcgcctgcggggccggg
ccggaggcggtggtcgaggcggcgagccgcgaggccgacctcgtcgtggcggcggtgagc
ggcgcggcggggctcggcccgacccacgcggcgatccggctcgggcgcaccgtcgccctc
gccaacaaggagagcctcgtctgcgcgggcgacgccttcatgcgcgacgcgcggcgctac
ggggcccgcatcctgccgatggattccgagcacaacgccctcgcccaggcgatcggcgag
ggcaaggtcgaggacatcacccggatgaccatcacggcctcgggcgggcccttccgcacg
gccccgcgcgagaccatcgcggcggcgagcgccgcccaggccgccgcccacccgacctgg
tcgatgggcatgaagatcaacatcgattccgccaccctgatgaacaagggcctcgaactc
gtcgaggcgcaccacctcttcgccatcgaggccgagcggctcgacgtcgtggtccacccc
caatccatcgtccacggcctggtgacgtggcgggacggggcggtgacggccgggctcgcg
atgccggacatgcgggtgccgatcgcccattgcctcggcatcggcgagcgcctgaccgtc
gcgcgggggcgccccgtcgacctcgccgccaccggcagcctcaccttcgagcgaccggac
gaggagcgcttcccctgcctgcgcatcgcgaaggccgcgctcgccacgggcggcgcgcag
ccgacggtgatgaacgccgccaacgagatcgcggtcgcggcgttcatcgccgggcgcatc
ggcttctacgacatcgccgccctcgtcgagcgggcctgcgcggccttcgcggcccgcttc
cccgccgccccggccgacgtcggggaggcgctcgccatggacgacgaggtgcggcgctgg
agcgcgcaggccctcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system