KEGG   Methylobacterium sp. 4-46: M446_0850Help
Entry
M446_0850         CDS       T00679                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
met  Methylobacterium sp. 4-46
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:met03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
962290..962907
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVVDSYGEDFVILDVHGVGYEVHCSARTLQRLPPAGEATDLAIETVVREDMIRL
YGFRSDAEREWFRLLQTVQGVGTRVALGLLSVLEPAELATAIATGDKGAVARAPGVGPRL
AARLVAELKDKAPAFAPVDPALVRLAGAVEARTAPQPVADAISALVNLGYPQAQASAAVA
AALQSAGAEAEAKTLIRLGLRELAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctgaagggtgtggtcgattcctacggcgaggatttcgtgatcctcgac
gtgcacggcgtcggctacgaggtacattgctcggcgcgcacgctgcagcggctgccgccg
gccggcgaggcgacggacctcgccatcgagacggtggtccgcgaggacatgatccggctc
tacggcttccggtcggacgcggagcgggaatggttccgcctgctccagaccgtgcagggg
gtcggcacccgggtggcgctcggcctgctctcggtgctggagccggccgagctcgccacc
gccatcgccaccggcgacaagggcgcggtcgcccgcgccccgggcgtcgggccgcggctc
gccgcccgcctggtcgccgaattgaaggacaaggcgccggccttcgccccggtcgatccg
gcgctcgtgcgcctcgcgggcgcggtcgaggcgcgcaccgcgccccagccggtggcggac
gcgatctccgccctcgtcaatctcggctacccgcaggcccaggcctcggccgccgtcgcg
gcggccctccagagcgcgggggccgaggcggaggccaagacgctgatccgcctcggcctg
cgcgaactcgcccggtag

DBGET integrated database retrieval system