KEGG   Methylobacterium sp. 4-46: M446_1127Help
Entry
M446_1127         CDS       T00679                                 

Definition
glycoside hydrolase family protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
met  Methylobacterium sp. 4-46
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M446_1127
Enzymes [BR:met01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     M446_1127
Exosome [BR:met04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M446_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1254552..1256498)
Genome map
AA seq 648 aa AA seqDB search
MPASQTHIGPDTPMGATARPGGCTFRCWAPRALGVWVTGSFNGWSPRAEAQRLVRDPSGC
WAGFVPGVGAGAQYKFYVDGPGSRGYKRDPHAREIVAPDWNCVVTDPAAYPWHDAGFRPP
AYEDLIIYQLHVGTFFAVDAAGADRRQGRVATFLDAIDRIPYLAELGVTAVQPLPIVEFP
TAFSLGYNGTDYFSPEFTYAVPEAELGPSLRRANALLAARGHAPVAAADIRDAAGQLRLF
VDLLHVHGIAVLFDVVYNHAGGDFGDESLYFFDRVPQGNNNDSLYFTDRGWAGGLVFAYW
NAPVRRFLIDNAVFLAREFHVDGLRYDEVSVIDAFGGWSFCQDLTAALRGAKPSAVQVAE
YWAPDQAACVRPAAEGGAGFDLVWHAGLRESVRQALAQAAGGRDADVNLDPVAQALAAWN
GLPQRWRAVQMLENHDVLLVAHEAKDRRPRVPAAADPSNARSWYARSRSRVATGLLLTGP
GIPLLFMGQEFLEDKLWSDSPDDPDHRIWWDGLRQDRAMADFLRFTRELIGLRRAQPALT
RGEINVFHVHNLNRVIAYHRWLPGQGRDVVVAASLAEATRHGYALGFPRGGTWREAFNSD
VYDGWVNPAVAGNSGAIEAGGPPLHGLPHSAAVVLPANAVVVFVKEDP
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccagccagactcacatcggtcccgacacgccgatgggcgccacggcgaggccc
ggcggctgcactttccggtgctgggccccgcgcgccctcggcgtgtgggtgaccggctcg
ttcaacggctggtctcctcgcgcggaggcgcagcggctggtgcgcgatccctccggctgc
tgggccggcttcgtaccgggcgtcggcgcgggcgcgcagtacaagttctacgtcgacggg
ccgggctcgcggggatacaagcgcgaccctcacgcgcgcgagatcgtcgccccggactgg
aactgcgtggtgaccgatccggcggcctatccctggcacgatgcggggttccgcccgccg
gcctacgaggacctgatcatctaccagctccatgtcgggaccttcttcgccgtcgacgcg
gcgggggcggaccggcgccagggccgggtcgccaccttcctggacgcgatcgaccggatc
ccctacctcgccgagctcggcgtcacggccgtgcagccgctgccgatcgtggaattcccg
accgccttcagcctcggctacaacggcaccgactatttctcgccggaatttacctatgcg
gtgccggaggccgaactcggcccctccctgcggcgcgccaacgccctcctggccgcgcgc
ggccacgcccccgtggcggcggccgacatccgggacgccgccgggcagctgcgcctgttc
gtcgacctgctgcacgtccacggcatcgcggtgctgttcgacgtcgtctacaatcacgcg
ggcggtgatttcggcgacgagagcctgtacttcttcgaccgggtcccgcagggcaacaac
aacgacagcctctacttcacggaccggggctgggcgggcggcctcgtcttcgcgtactgg
aacgccccggtgcgccggttcctgatcgacaatgccgtgttcctggcccgggaattccac
gtcgacgggctgcgctacgacgaggtgagcgtcatcgacgcgttcggcggctggtccttc
tgccaggacctgacggcggccctgcgcggcgccaagccctcggccgtgcaggtcgcggag
tactgggcgcccgatcaggccgcctgcgtgcgcccggcggcggagggcggcgcgggcttc
gacctcgtctggcacgcgggcctgcgcgagagcgtgcggcaggcgctcgcccaggcggcg
ggcgggcgcgacgcggacgtgaacctcgacccggtcgcgcaggccctggcggcgtggaac
ggcctcccgcagcgctggcgcgcggtccagatgctggagaaccacgacgtcctgctcgtc
gcccacgaggcgaaggaccggcgcccgcgcgtcccggccgccgccgatccgtcgaacgcg
cgctcgtggtacgcgcgcagccgctcgcgggtcgcgacgggcctgctcctcaccggcccc
ggcatcccgctcctgttcatgggtcaggagttcctggaggacaagctctggagcgattcc
cccgacgatcccgaccaccgcatctggtgggacggcctgcggcaggaccgggcgatggcg
gatttcctgcgcttcacgcgcgagctgatcggcctgcgccgggcgcagccggcgctgacc
cgcggcgagatcaacgtcttccacgtccacaatctcaaccgcgtcatcgcgtatcatcgc
tggctgccgggccaggggcgggacgtggtcgtcgccgcgagcttggcggaggccacgcgg
cacggctacgccctcgggttcccgcggggcgggacgtggcgcgaggccttcaacagcgac
gtctacgacggctgggtcaatccggcggtcgccggcaattccggcgcgatcgaggcgggc
ggcccgccgctgcacggactgccgcactcggcggcggtggtcctgccggccaacgccgtc
gtggtcttcgtcaaggaggacccgtga

DBGET integrated database retrieval system