KEGG   Methylobacterium sp. 4-46: M446_1287Help
Entry
M446_1287         CDS       T00679                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
met  Methylobacterium sp. 4-46
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:met00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:met02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1417128..1417496)
Genome map
AA seq 122 aa AA seqDB search
MRIVLASAAVLAALCTSGHAQGSGDPAAGEKAFATCKACHAFGKNGVGPNLTGVVGRKSA
SVEGYSYSAALKGSGITWDEANLHEWLKNPKAKVPGTKMIFAGYPDDKKVDDVIAYLKQH
TQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgtattggcaagtgcagccgtgctcgcggcgctgtgcacatcgggacacgcg
caggggagcggcgacccggctgccggcgagaaggcattcgcaacatgcaaagcctgccac
gcattcggaaaaaacggtgtcggccccaacctgaccggcgtcgtcgggcgcaagtcggca
tccgtcgagggatacagttactcggcggctttgaaaggctcaggcattacctgggatgag
gccaatctgcacgaatggctgaagaaccccaaggcgaaagtccctggaacgaagatgatc
ttcgccggctacccggacgacaagaaggtcgatgacgtgattgcctatttgaagcagcac
acccagtaa

DBGET integrated database retrieval system