KEGG   Methylobacterium sp. 4-46: M446_1550Help
Entry
M446_1550         CDS       T00679                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
met  Methylobacterium sp. 4-46
Brite
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     M446_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1728137..1729210
Genome map
AA seq 357 aa AA seqDB search
MPSVDLVTGGCGFIGRNLVASLLAAGRTVRVFDCGDPHGLPACVEYRRGSVLDEAALSAA
MNGVGQVYHLAGIPHLWSADRGAFARVHANGTRCLLAAAPAAVRVVHCSTEAVLLTRSRD
VAPVRGDDLPPLDRMSGPYTRSKCLAEQAALAAAAAGRHVVIASPTVPIGPDDRNMTPPA
AMLSLFLNGHAPVFLDCTLNLVDVRDAAEGLRLAGARGRPGQRYVLGGENVRLRQLLARL
EHLSGRPMPSVALPGGIAMTVAAVAEWAADHLTRRPPVATREGVRLARRSAPFDDGKARR
ELGYRPRPIDEALALAVAWLMSGATSRGDAAAPGAGTAAQGHAHPVAPISRNTSDAA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgtcgatctcgtcacgggtggatgcggtttcatcggccggaatctggtcgcg
tcgctgcttgccgccgggcgtaccgtgcgggtgttcgattgcggcgacccgcacggcctt
ccggcttgcgtcgagtatcgccgcggctccgtgctcgacgaagccgcgctctcggccgcg
atgaacggggtcgggcaggtctaccatctcgccgggatcccgcacctgtggtccgccgac
cggggggccttcgcccgcgtccacgcgaacgggacgaggtgcctgctggccgccgcgcct
gccgcggtgcgggtggtccattgctcgaccgaggccgtgctgctcacccgatcgcgcgac
gttgcgccggtgcgcggggacgatctcccgcccctcgaccggatgtccggtccctatacg
cggtcgaaatgcctcgccgaacaggcagcgctcgccgccgcggcggccggacgccacgtc
gtgatcgcgagccccacggtgccgatcgggcccgacgaccggaacatgacgccgcccgcg
gccatgctgtccctgttcctgaacgggcatgcaccggtcttccttgattgcacgctgaac
ctcgtcgacgtgcgcgacgcagccgaagggctccgcctcgcgggcgcgcgggggcgtcct
ggtcagcgctacgtgctgggcggtgagaacgttcggcttcggcaactcctggccaggctg
gagcatctgtcgggccggccgatgccgtccgtggcgctcccgggcggcatcgccatgacg
gtggcggccgtggccgagtgggccgccgatcacctcacgcgacgccctccggtcgccacg
cgcgaaggtgtgcgcctcgcgcgtcgctcggccccgttcgacgacggcaaggcccgcagg
gaactcggatacaggccgagaccgatcgacgaagccctggcgctggcggtggcctggctc
atgagcggcgcgacctcgcgcggcgatgcggccgcgccgggcgcaggcacggctgctcag
ggtcacgctcacccggttgcgcccatctcgcgcaacacctcggacgcggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system