KEGG   Methylobacterium sp. 4-46: M446_1618Help
Entry
M446_1618         CDS       T00679                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
met  Methylobacterium sp. 4-46
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    M446_1618
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M446_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1811273..1811812)
Genome map
AA seq 179 aa AA seqDB search
MDSFELNKVAGAVLGTLLFAMGTGFLAELIYKPKPAGDRGYALAAATEAPAGGGEAAPKE
EPLPVRLASADAAKGQSAAKKCAACHNFDKGGANKVGPNLWGVVGRPKGSHEGFNYSAAM
KAKGGDWSYEDLDQFIHNPKGYVQGTIMAFAGVSSGAERADILAYLKTLSDKPVDFPKP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagcttaacaaggtcgccggtgccgtgctcggcacgctgttgttcgcg
atgggcacgggcttcctcgccgagctgatctacaagccgaagccggcgggcgatcgcggc
tacgcgctcgcggccgccaccgaggcgccggcgggcggcggcgaggcggcgcccaaggag
gagcccctgccggtgcgcctcgccagcgccgacgccgccaagggccagtcggcggccaag
aaatgtgcggcctgtcacaacttcgacaagggcggcgcgaacaaggtcgggccgaatctc
tggggcgtcgtgggccggccgaagggcagccacgagggcttcaactactcggccgcgatg
aaggccaagggcggcgactggagctacgaggacctggaccagttcatccacaacccgaag
ggctacgtgcagggcacgatcatggccttcgcgggcgtgtcctccggcgccgagcgcgcc
gacatcctggcctacctgaagacgctctcggacaagccggtcgactttcccaagccctga

DBGET integrated database retrieval system