KEGG   Methylobacterium sp. 4-46: M446_1805Help
Entry
M446_1805         CDS       T00679                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M446_1805
   00052 Galactose metabolism
    M446_1805
   00500 Starch and sucrose metabolism
    M446_1805
   00520 Amino sugar and nucleotide sugar metabolism
    M446_1805
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M446_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2021326..2022195)
Genome map
AA seq 289 aa AA seqDB search
MMKPIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGR
GKGVIEDHFDIAFELDRTLQERGKQAAYEELKRDLPQAGQTSFTRQQAPLGLGHAVWCAR
EIVGDEPFAVILPDMLSRDSMRQMLAAYERHGGNVIAVEEVPHDQTHQYGIVSVGEDFGD
TFEITGMVEKPPRGTAPSNLIISGRYILQPEIFDILGRGEKGAGGEIQLTDGMKRLAETQ
AFYGMRYRGKTYDTGSKLGFLVANLAYALARDDLRDDLKREIAELLRTA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcccattcgcaaagcagtcctgcccgtcgcgggtctgggcacccgcttcctc
ccggcgaccaaggcggtgcccaaggagatgctgacggtcgtggaccggccggtggtgcag
cacgtggtcgacgaggcgagggaggcgggaatcgagcacttcatcttcgtgaccggccgc
ggcaagggcgtgatcgaggaccatttcgacatcgccttcgagctcgaccgcaccctgcag
gagcgcggcaagcaggcagcctacgaggagttgaagcgcgacctgccgcaggccgggcag
accagcttcacccgccagcaggcgccgctcggcctcggtcacgcggtctggtgcgcccgc
gagatcgtcggcgacgagcccttcgcggtgatcctgcccgacatgctgagccgcgactcg
atgcggcagatgctcgccgcctacgagcgccacggcggcaacgtcatcgcggtcgaggag
gtgccccacgaccagacccaccagtacggcatcgtcagcgtgggcgaggatttcggcgac
acgttcgagatcaccggcatggtggagaagccgccgaggggcaccgcgccttccaacctc
atcatctcgggccgctacatcctgcagccggagatcttcgacatcctcggccggggcgag
aagggcgcgggcggcgagatccagctcaccgacggcatgaagcggctggccgagacccag
gccttctacgggatgcgctaccgcggcaagacctacgacaccggctcgaagctcggcttc
ctggtcgccaacctcgcctacgccctcgcgcgcgacgacctgcgcgacgacctcaagcgc
gaaatagccgagctgctgcgcacagcgtga

DBGET integrated database retrieval system