KEGG   Methylobacterium sp. 4-46: M446_1825Help
Entry
M446_1825         CDS       T00679                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00220  Arginine biosynthesis
met00330  Arginine and proline metabolism
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01130  Biosynthesis of antibiotics
met01230  Biosynthesis of amino acids
Module
met_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    M446_1825
   00330 Arginine and proline metabolism
    M446_1825
Enzymes [BR:met01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     M446_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACA16309
JGI: M4461825
UniProt: B0U8H9
Position
2049941..2050870
Genome map
AA seq 309 aa AA seqDB search
MRGSRCVLVGVPVQAGAGRRGCDMGPSAYRAAGIAEAVSDLGFAVVDAGNLAAPPWPAQV
HPNPAIRQLPEVAGWTATLAEAAEQLAAESLPLFLGGDHSLSAGTIAGMSRRARTEGRPL
FVLWLDSHPDFHTLDTTRSGNLHGVPMAYVTGRPGFAGYFPPLEAPLDPRRVCMIGLRSV
DPDERTALREAGVTVHDMRTIDEEGIARPLASFLDQVAAAEGLLHVSLDVDFLDPGIAPG
VGTTVPGGTTFREAHLVMEMLHDSGLVRALDLVELNPFLDERGRTALLMVDLAASLLGRR
VLDRPTRSY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggatcgcgatgcgtgctggtgggggttccggttcaggcgggggccggccgccgg
ggctgcgacatgggcccgagcgcctaccgggccgccgggatcgccgaggcggtgagcgac
ctcggcttcgccgtggtcgatgcgggcaacctcgcggcgccgccctggccggcgcaggtc
cacccgaaccccgccatccgccaattgcccgaggtggcgggctggaccgcgaccctcgcc
gaggccgccgagcaactcgccgccgagagcctgccgctcttcctcggcggcgaccacagc
ctctcggccggcaccatcgcgggcatgagccggcgcgccaggaccgaggggcggcctctc
ttcgtgctctggctcgattcgcacccggacttccacaccctcgacacgacgcgcagcggc
aacctgcacggggtgccgatggcctacgtcaccgggcggccgggcttcgccggctacttc
ccgcccctcgaggcgcccctcgatccgcgccgggtctgcatgatcggcctgcgcagcgtc
gatcccgacgagcgcacggcgctgcgcgaggcgggcgtgacggtgcacgacatgcgtacc
atcgacgaggagggcatcgcgcgccccctcgcgtccttcctcgaccaggtcgcggcggcg
gaggggctgctgcatgtcagcctcgacgtcgacttcctcgatcccggcatcgcgccgggg
gtcggcaccaccgtgccggggggcaccaccttccgcgaggcgcatctcgtgatggagatg
ctgcacgacagcggcctcgtgcgcgccctcgacctcgtggagctcaaccccttcctcgac
gagcgcgggcgcaccgcgctcctgatggtcgacctcgccgcgagcctgctcggccggcgc
gtcctcgaccgtccgacccggagctactga

DBGET integrated database retrieval system