KEGG   Methylobacterium sp. 4-46: M446_1825Help
Entry
M446_1825         CDS       T00679                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M446_1825
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M446_1825
Enzymes [BR:met01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     M446_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2049941..2050870
Genome map
AA seq 309 aa AA seqDB search
MRGSRCVLVGVPVQAGAGRRGCDMGPSAYRAAGIAEAVSDLGFAVVDAGNLAAPPWPAQV
HPNPAIRQLPEVAGWTATLAEAAEQLAAESLPLFLGGDHSLSAGTIAGMSRRARTEGRPL
FVLWLDSHPDFHTLDTTRSGNLHGVPMAYVTGRPGFAGYFPPLEAPLDPRRVCMIGLRSV
DPDERTALREAGVTVHDMRTIDEEGIARPLASFLDQVAAAEGLLHVSLDVDFLDPGIAPG
VGTTVPGGTTFREAHLVMEMLHDSGLVRALDLVELNPFLDERGRTALLMVDLAASLLGRR
VLDRPTRSY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggatcgcgatgcgtgctggtgggggttccggttcaggcgggggccggccgccgg
ggctgcgacatgggcccgagcgcctaccgggccgccgggatcgccgaggcggtgagcgac
ctcggcttcgccgtggtcgatgcgggcaacctcgcggcgccgccctggccggcgcaggtc
cacccgaaccccgccatccgccaattgcccgaggtggcgggctggaccgcgaccctcgcc
gaggccgccgagcaactcgccgccgagagcctgccgctcttcctcggcggcgaccacagc
ctctcggccggcaccatcgcgggcatgagccggcgcgccaggaccgaggggcggcctctc
ttcgtgctctggctcgattcgcacccggacttccacaccctcgacacgacgcgcagcggc
aacctgcacggggtgccgatggcctacgtcaccgggcggccgggcttcgccggctacttc
ccgcccctcgaggcgcccctcgatccgcgccgggtctgcatgatcggcctgcgcagcgtc
gatcccgacgagcgcacggcgctgcgcgaggcgggcgtgacggtgcacgacatgcgtacc
atcgacgaggagggcatcgcgcgccccctcgcgtccttcctcgaccaggtcgcggcggcg
gaggggctgctgcatgtcagcctcgacgtcgacttcctcgatcccggcatcgcgccgggg
gtcggcaccaccgtgccggggggcaccaccttccgcgaggcgcatctcgtgatggagatg
ctgcacgacagcggcctcgtgcgcgccctcgacctcgtggagctcaaccccttcctcgac
gagcgcgggcgcaccgcgctcctgatggtcgacctcgccgcgagcctgctcggccggcgc
gtcctcgaccgtccgacccggagctactga

DBGET integrated database retrieval system