KEGG   Methylobacterium sp. 4-46: M446_1966Help
Entry
M446_1966         CDS       T00679                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:met00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2193065..2194588)
Genome map
AA seq 507 aa AA seqDB search
MASPPHSPLILAIDQGTTSTRALLFRADTSVAALAQAEFPQHFPASGWVEHEPDDLWRTT
LATCRAALERAGARAGDVAAIGITNQRETTLVWDRRTGEAVHRAIVWQDRRTAGLCARLR
AQGHEPLVAARTGLILDPYFSGTKIAWILDNVPGARARAEAGDLAFGTVDSYLLWRLTGG
RLHVTDATNAARTLLFDIHRGTWDDDLLGLLGIPRAMLPEVRDSSGDFGATDPDLFGAAI
PIRGVAGDQQAATVGQACFRPGMVKSTYGTGCFALLNTGAQPVASGNKLLTTIAYQLDGR
RTYALEGSIFVAGAAVQWLRDGLKVVGSAAETGDLAERADPAQDVYLVPAFVGLGAPYWE
PDVRGALYGLTRNTGPAELARAALESVCYQTADLLAAMRADWPDGDGRATVLRVDGGMVA
SDWTMQRLADLLAAPVDRPEVKETTALGAAYLAGLACGLYPDPEHFADHWRLERRFAPAM
DAPVRARKLAGWRKAVGCLLGRTEPVP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccccgcactctcccctcatcctggccatcgaccagggcaccacctcgacg
cgggccctgctcttccgcgccgacacgtcggtggcggccctcgcccaggccgagttcccg
cagcacttcccggcctcgggctgggtcgagcacgagccggacgacctctggcgcaccacc
ctcgccacctgccgggccgccctggagagggcgggggcgcgggcgggcgacgtcgcggcg
atcggcatcaccaaccagcgcgagacgaccctggtctgggaccgccgcaccggcgaggcg
gtgcaccgggcgatcgtctggcaggaccggcgcaccgccgggctctgcgcccgcctcagg
gcgcagggccacgagcccctggtcgccgcgcggaccggcctcatcctcgatccctacttc
tcgggcaccaagatcgcctggatcctcgacaacgtgccgggcgcgcgggcccgcgcggaa
gcgggcgacctcgccttcggcacggtcgacagctacctgctgtggcggctcaccggcggg
cggctccacgtcacggacgccaccaacgcggcgcgcacgctcctcttcgacatccaccgc
ggcacctgggacgacgacctcctcggcctcctcggcatcccccgcgccatgctgccggag
gtgcgcgattcctcgggcgatttcggcgccacggacccggacctgttcggcgccgcgatc
ccgatccgcggcgtcgccggcgaccagcaggccgcgaccgtgggccaggcctgcttccgg
cccggcatggtgaaatcgacctacggcaccggctgcttcgcgctcctcaacaccggcgcg
cagccggtcgcgtcgggcaacaagctcctcaccaccatcgcctaccagctcgacggccgg
cgcacctacgccctcgaaggctcgatcttcgtggccggggcggcggtgcagtggctgcgc
gacgggctcaaggtcgtgggctcggcggcggagaccggggacctcgccgagcgggccgat
ccggcccaggacgtgtacctcgtgccggccttcgtggggctcggcgcgccctactgggag
ccggacgtgcgcggcgccctctacggcctcacccgcaacaccggcccggcggaactcgcc
cgcgccgccctggagagcgtctgctaccagaccgcggacctgctcgcggcgatgcgggcg
gattggccggacggggacgggcgcgccaccgtgctgcgggtcgacggcggcatggtcgcc
tcggactggaccatgcagcgcctcgccgatctcctcgccgccccggtcgaccggccggag
gtgaaggagacgacggcgctcggcgccgcctacctcgccggcctcgcctgcgggctctac
ccggacccggagcatttcgccgaccattggcgcctggagcgccgcttcgcgccggccatg
gacgcgcccgtgcgcgcgcgcaagctcgccggctggcgcaaggcggtgggctgcctgctc
gggcggaccgagccggtgccgtga

DBGET integrated database retrieval system