KEGG   Methylobacterium sp. 4-46: M446_2162Help
Entry
M446_2162         CDS       T00679                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
met  Methylobacterium sp. 4-46
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M446_2162
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M446_2162
   00640 Propanoate metabolism
    M446_2162
   00660 C5-Branched dibasic acid metabolism
    M446_2162
Enzymes [BR:met01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     M446_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2409581..2410777
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLKEFGLPVSNGKAIFKAAEAEAAARELGGPLWVVKSQIHAGGRGKGKFK
EAKAGEKGGVRLAKSIDEVKTFAEQMLGRTLVTVQTGEAGKQVNRLYIEDGSDIDTEFYL
SMLVDRATGRVAYVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGVMPHHGRAVAKALGLS
GPLAKEAEDLTARLYQAFTAKDMSMLEINPLIVTKDGHLKCLDAKISFDSNALYRHPEIV
QLRDTTEEDEKEIEASKYDLAYIALEGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPNVKGILVNIFGGIMKCDVIANGVIAAVKAVGLQVPLVVRLE
GTNVEKGKEIIRSSGLNVIPADDLDDAAQKIVAAVRQR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaagccaaggcggtgctgaaggagttcggcctgccggtctcc
aacggcaaggccatcttcaaggccgcggaagccgaggccgccgcccgcgaactcggcggg
ccgctctgggtggtcaagtcccagatccacgccggcgggcgcggcaagggcaaattcaag
gaggccaaggccggcgagaagggcggcgtgcgcctcgccaagtcgatcgacgaggtcaag
accttcgccgagcagatgctcgggcgcaccctcgtgacggtgcagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggacggctcggacatcgacaccgagttctacctc
tcgatgctggtcgaccgcgcgaccggccgggtcgcctacgtggtctcgaccgagggcggc
atggatatcgagcaggtcgcccacgacacgcccgagaagatcgtgaccttctcggtcgat
ccggcgacgggcgtgatgccccatcacggccgcgcggtcgccaaggcgctcggcctctcg
ggcccgctcgccaaggaggcggaggatctcaccgcccggctctaccaggcgttcaccgcc
aaggacatgagcatgctggagatcaacccgctgatcgtgaccaaggacgggcacctgaag
tgcctggacgccaagatctccttcgactcgaacgccctctaccgccacccggagatcgtg
cagctgcgcgacacgaccgaggaggacgagaaggagatcgaggcctcgaagtacgacctc
gcctacatcgcgctcgagggcacgatcggctgcatggtcaacggcgccggcctcgccatg
gcgacgctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgacgtcggc
ggcggcgcctccgaggagaaggtgacggcggccttcaagatcatcacggccgacccgaac
gtgaaggggatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtgatcgccaac
ggcgtgatcgcggccgtcaaggcggtgggcctgcaggtgcccctggtggtgcgcctcgaa
ggcaccaacgtcgagaagggcaaggagatcatccgctcctcggggctcaacgtcatcccg
gcggacgatctcgacgacgcagcccagaagatcgtcgcggccgtgcgccagcgctga

DBGET integrated database retrieval system