KEGG   Methylobacterium sp. 4-46: M446_2166Help
Entry
M446_2166         CDS       T00679                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
met  Methylobacterium sp. 4-46
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M446_2166
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M446_2166
  Amino acid metabolism
   00310 Lysine degradation
    M446_2166
Enzymes [BR:met01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     M446_2166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2415240..2416496
Genome map
AA seq 418 aa AA seqDB search
MATEIRVPTLGESVNEATIGRWFKKPGDTVKADEPLVELETDKVTLEVNAPAAGKLGDIV
AKDGETVEPGALLGSIVEGAGNGAAEAAPAPKAAPAPAAAPAQTSSASYGSHGDAAPPGA
RAAQDHGPAVARLAQETGVDPASLQGSGKDGRVTKGDMLAAASGAAAPAPAPLPQVARAP
SAPDDAAREERVRMTKLRQTIARRLKDAQNIAAMLTTFNDVDMSAVMALRQQYKDVFEKK
HGTKLGFMGFFTKAVIQALKDVPAVNAEIDGQDIVYKNYYHIGIAVGTDKGLVVPVVRDA
DNLSIAGIEKTIANFGRKARDGKLSIDEMQGGTFTITNGGIYGSLMSTPILNAPQSGILG
MHRIEERPVVRGGKIEARPMMYLALSYDHRIVDGKEAVTFLVRVKEALEDPARLVLDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaatccgcgtcccgaccctgggcgagtccgtgaacgaggccacgatcggc
cgctggttcaagaagccgggcgacaccgtgaaggccgacgagccgctggtcgagctcgag
accgacaaggtgacgctcgaggtcaacgccccggccgccggcaagctcggcgacatcgtc
gccaaggacggcgagaccgtcgagcccggcgcgctcctcggctcgatcgtcgagggcgcc
ggcaacggcgcggccgaggccgcccccgccccgaaggcggccccggcgcccgccgcggcc
ccggcccagacctcctcggcctcctacggcagccacggcgacgccgccccccccggcgcc
cgcgccgcccaggaccacggcccggcggtggcccgcctcgcccaggagaccggcgtcgac
cccgcctccctgcagggcagcggcaaggacggccgcgtgaccaagggcgacatgctggcg
gcggcctccggcgccgcggccccggccccggcgcccctgccgcaggtcgcccgcgccccc
tcggcgcccgacgacgccgcgcgcgaggagcgcgtgcggatgaccaagctgcgccagacc
atcgcccgccggctcaaggacgcgcagaacatcgccgccatgctgacgacgttcaacgac
gtcgacatgagcgccgtcatggccctgcgccagcagtacaaggacgtcttcgagaagaag
cacggcaccaagctcggcttcatgggcttcttcaccaaggcggtgatccaggccctgaag
gacgtgccggccgtgaacgccgagatcgacggtcaggatatcgtctacaagaactactac
cacatcggcatcgcggtcgggaccgacaagggcctggtcgtgccggtggtgcgcgacgcc
gacaacctgtcgatcgccggcatcgagaagacgatcgcgaatttcggccgcaaggcgcgc
gacggcaagctctcgatcgacgagatgcagggcggcaccttcacgatcaccaatggcggc
atctacggctcgctgatgtcgacgccgatcctgaacgcgccgcaatcgggcatcctcggc
atgcaccgcatcgaggagcggccggtggtgcgcggcggcaagatcgaggcgcggccgatg
atgtacctcgccctgtcctacgatcaccggatcgtcgacgggaaggaggccgtgaccttc
ctggtgcgggtcaaggaggcactggaggatccggcgcggctcgtgctcgacctctga

DBGET integrated database retrieval system