KEGG   Methylobacterium sp. 4-46: M446_2482Help
Entry
M446_2482         CDS       T00679                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
met  Methylobacterium sp. 4-46
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:met00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:met00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2751178..2752203
Genome map
AA seq 341 aa AA seqDB search
MTTLALILGCAGRTLSAEEAAFFRAVQPWGFILFKRNIGTPEEVRALTASLRDTVGRADA
PILIDQEGGRVQRMGPPHWRAYPAAARFLQAGGPEEGPALARLGARLMAHDLAGVGISVD
CAPVLDVPVAGANAVIGDRAYADDPREVAAFGRAVAEGLMAGGVLPVIKHVPGHGRANAD
SHLALPVVTAPRAALEAQDFAPFRALADLPLAMSAHVVFTALDPEQPATTSATVIREVVR
GALGFDGLLMTDDLSMKALSGSFRGRTEAAFRAGIDVALHCNGERAEMEEVAAAAPGLAG
DALRRAEAALARRIPANPDFDPAEAAARLEAGLRMRPSAVA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctcgccctgatcctcggctgcgccggccgcacgctctcggccgaggaggcc
gccttcttccgcgcggtgcagccctggggcttcatcctgttcaagcgcaacatcggaacg
cccgaggaggtgcgcgcgctcaccgcctccctgcgcgacacggtggggcgggccgacgcg
ccgatcctgatcgatcaggagggcggacgggtgcagcgcatgggaccgccgcattggcgg
gcctatccggcggccgcgcgcttcctgcaggcggggggccctgaggaggggccggcgctc
gcccgcctcggcgcgcgcctgatggcgcacgacctcgccggggtggggatcagcgtcgat
tgcgcccccgtcctcgacgtaccggtcgcgggcgcgaacgcggtcatcggggaccgggcc
tacgccgacgacccgcgggaggtggcggccttcggccgcgccgtcgccgagggtctgatg
gcgggcggcgtgctgccggtgatcaagcacgtgccgggccacggccgggccaatgccgac
agccacctcgcgctgccggtggtgaccgccccgcgggcggcccttgaggcgcaggatttc
gccccgttccgggcgctggccgacctgcctctcgccatgtcggcccacgtcgtcttcacc
gccctcgatccggagcaaccggccaccacctccgcgacggtgatccgcgaggtcgtgcgc
ggcgcgctcggcttcgacggcctgctgatgaccgacgacctctcgatgaaagccctgtcc
gggagtttccgcggccgcaccgaggcggcgttccgggccggcatcgacgtggcgctccac
tgcaacggcgagcgggccgagatggaggaggtcgccgcggccgcgccgggcctggccggc
gacgccctgcggcgcgccgaggcggccctggcgcggcgcatcccggccaatcccgatttc
gatccggccgaggccgccgcccggctcgaggccgggctgcggatgcgcccgagcgccgtg
gcctga

DBGET integrated database retrieval system