KEGG   Methylobacterium sp. 4-46: M446_2507Help
Entry
M446_2507         CDS       T00679                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M446_2507
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M446_2507
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M446_2507
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M446_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2775465..2776685
Genome map
AA seq 406 aa AA seqDB search
MNAPQTPNSFRTGPDERGRFGIFGGRFVAETLMPNILELERAYAEAKADPAFQGEMNAYL
THYVGRPSPLYFAERLSAHFGGAKIYFKREELNHTGSHKVNNVLGQILLARRMGKPRIIA
ETGAGQHGVATATLCARFGLKCVVYMGAVDVERQKPNVFRMKMLGAEVVPVQSGTRTLKD
AMNEALRDWVTNVADTFYCIGTVAGPHPYPAMVRDFQSVIGRETREQMLAQEGRLPDSLV
ACIGGGSNAMGLFHPFLDDREIEIYGVEAAGHGVSSGLHAASLTGGKPGVLHGNRTYLLM
NEDGQIADAHSISAGLDYPGIGPEHAWLHEVGRVTYLSATDSETLEAFRLCSLMEGIIPA
LEPAHALAKVAELAPTKPRDHLMVVNLSGRGDKDIPQVAEILGDAL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctccccagactccgaattccttccgcaccggccccgacgagcgcggccgcttc
ggcatcttcggcggccgcttcgtggccgagacgctgatgcccaacatcctcgaactggag
cgggcctacgcggaagccaaggccgacccggccttccagggcgagatgaacgcctacctc
acccactacgtcggccggccgagcccgctctacttcgccgagcggctctccgcgcatttc
ggcggcgccaagatctacttcaagcgcgaggagctgaaccacaccggctcgcacaaggtg
aacaacgtgctgggccagatcctgctcgcccggcgcatgggcaagccgcgcatcatcgcc
gagaccggggccggccagcacggggtggcgacggccacgctctgcgcccgcttcggcctg
aaatgcgtcgtctacatgggcgcggtcgacgtggagcggcagaagccgaacgtcttccgc
atgaagatgctgggcgccgaggtggtgccggtgcagtcgggcacccgcaccctcaaggac
gcgatgaacgaggccctgcgcgactgggtgacgaacgtcgccgacaccttctactgcatc
ggtacggtggcgggcccgcacccctatccggcgatggtgcgggatttccagtcggtgatc
ggccgcgagacgcgcgagcagatgctggcccaggaggggcggctgcctgattccctggtc
gcctgcatcggcggcggctcgaacgcgatgggcctgttccaccccttcctggacgaccgc
gagatcgagatctacggggtcgaggcggcgggccacggcgtctcctcggggctgcacgcg
gcctcgctgaccggcggcaagcccggcgtgctgcacggcaaccgcacctacctgctgatg
aatgaggacggccagatcgcggacgcgcactcgatctcggccggcctcgactatccgggc
atcggcccggagcacgcgtggctgcacgaggtcggccgggtgacctacctgtcggcgacc
gacagcgagacgctggaggccttccggctgtgctccctgatggagggcatcatcccggcc
ctggagccggcccacgccctcgccaaggtggccgaactcgcgccgacgaagccgcgcgac
cacctgatggtggtcaacctctcgggccggggcgacaaggacatcccgcaggtggccgag
atcctcggcgacgccctctga

DBGET integrated database retrieval system