KEGG   Methylobacterium sp. 4-46: M446_2748Help
Entry
M446_2748         CDS       T00679                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
met  Methylobacterium sp. 4-46
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:met00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3055829..3056746
Genome map
AA seq 305 aa AA seqDB search
MTSPTTCPTTCPTTCLTTRAPAKINLTLHVLGRRPEDGYHALESLVAFAGVGDTLTLEPG
PDLALVVSGPTAGPAGPTADNLVLRAARRLAALVPGLATGRFSLVKRLPVAAGIGGGSSD
AAAALRLLGRLNDLPADHPALIEAARGTGADVPVCLDPRARMMRGAGEAIGPALALPGLP
AVLINPGVPVETAPVFRALGLKVGEANPAASVPHPTIGPRLDGPALLALIGPARNDLEAP
ALTVAPVIGEALGALRERPGCRLARMSGSGATVFGLFGHRGRAAQAARAIAQARPGWWVR
ATILR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccccgaccacctgcccgaccacctgcccgaccacttgcctgaccacccgcgct
cccgcgaagatcaacctcacgctgcacgtcctcggccggcgaccggaggacggctatcac
gccctcgaaagcctggtggccttcgcgggggtcggcgacacgctgacgctggagcccggc
ccggacctcgcgctggtggtctccggcccgacggccgggcccgccggcccgacggccgac
aacctcgtgctccgcgcggcccgtcgcctcgccgccctggtccccggcctcgcgacgggg
cggttctcgctggtgaagcgcctgcccgtggccgccggcatcggcggcggctcgtcggac
gcggccgcggccctgcgcctgctcgggcgcctgaacgacctgccggccgatcacccggcc
ctgatcgaggcggcgcgcggcaccggggcggacgtgccggtctgcctcgacccgcgcgcc
cggatgatgcggggcgccggcgaagcgatcggaccggcgctcgccctgccgggcctgccc
gccgtgctgatcaatcccggcgtgccggtcgagaccgcaccggtcttccgggccctcggg
ctgaaggtcggcgaggccaacccggccgcgtcggtgccgcatccgacgatcggtccgcgg
ctcgacggcccggcgctgctcgccctgatcggcccggcccgcaacgacctcgaagcgcct
gccctgacggtggcgccggtcatcggcgaggcgctcggcgccctgcgcgagcggcccggc
tgccggctcgcccggatgtcgggctcgggcgcgacggtgttcggcctgttcgggcatcgc
ggccgcgccgcccaggcggcccgcgcgatcgcgcaggcgcggccgggctggtgggtccgc
gccacgatcctgcgctga

DBGET integrated database retrieval system