KEGG   Methylobacterium sp. 4-46: M446_2748Help
Entry
M446_2748         CDS       T00679                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
met  Methylobacterium sp. 4-46
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M446_2748
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     M446_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3055829..3056746
Genome map
AA seq 305 aa AA seqDB search
MTSPTTCPTTCPTTCLTTRAPAKINLTLHVLGRRPEDGYHALESLVAFAGVGDTLTLEPG
PDLALVVSGPTAGPAGPTADNLVLRAARRLAALVPGLATGRFSLVKRLPVAAGIGGGSSD
AAAALRLLGRLNDLPADHPALIEAARGTGADVPVCLDPRARMMRGAGEAIGPALALPGLP
AVLINPGVPVETAPVFRALGLKVGEANPAASVPHPTIGPRLDGPALLALIGPARNDLEAP
ALTVAPVIGEALGALRERPGCRLARMSGSGATVFGLFGHRGRAAQAARAIAQARPGWWVR
ATILR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccccgaccacctgcccgaccacctgcccgaccacttgcctgaccacccgcgct
cccgcgaagatcaacctcacgctgcacgtcctcggccggcgaccggaggacggctatcac
gccctcgaaagcctggtggccttcgcgggggtcggcgacacgctgacgctggagcccggc
ccggacctcgcgctggtggtctccggcccgacggccgggcccgccggcccgacggccgac
aacctcgtgctccgcgcggcccgtcgcctcgccgccctggtccccggcctcgcgacgggg
cggttctcgctggtgaagcgcctgcccgtggccgccggcatcggcggcggctcgtcggac
gcggccgcggccctgcgcctgctcgggcgcctgaacgacctgccggccgatcacccggcc
ctgatcgaggcggcgcgcggcaccggggcggacgtgccggtctgcctcgacccgcgcgcc
cggatgatgcggggcgccggcgaagcgatcggaccggcgctcgccctgccgggcctgccc
gccgtgctgatcaatcccggcgtgccggtcgagaccgcaccggtcttccgggccctcggg
ctgaaggtcggcgaggccaacccggccgcgtcggtgccgcatccgacgatcggtccgcgg
ctcgacggcccggcgctgctcgccctgatcggcccggcccgcaacgacctcgaagcgcct
gccctgacggtggcgccggtcatcggcgaggcgctcggcgccctgcgcgagcggcccggc
tgccggctcgcccggatgtcgggctcgggcgcgacggtgttcggcctgttcgggcatcgc
ggccgcgccgcccaggcggcccgcgcgatcgcgcaggcgcggccgggctggtgggtccgc
gccacgatcctgcgctga

DBGET integrated database retrieval system