KEGG   Methylobacterium sp. 4-46: M446_2827Help
Entry
M446_2827         CDS       T00679                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
met  Methylobacterium sp. 4-46
Brite
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     M446_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3143964..3145010)
Genome map
AA seq 348 aa AA seqDB search
MPTSAQRVSTRASTPQQDGLWSYLQALVATTLDTIREHGLHPSPAGFELLFRHHSRALPD
ADLGPLLARVRSLAQHGSSPPLPEIDLDAVHDGAEVLESEAGRLAAALSGSAQALATYGS
VLSACNDRLGAAPSAAMLMQSVALLTRETARVSARNAELEGELRQAGERIGKLQRNLASV
RQEASVDALTGIANRRAFTARLRRQLAQAKAEGAGPFCLVLLDVDHFKLFNDAHGHRTGD
QVLRLVARLLTDNVKGRDFVARYGGEEFALILSDVDAESGLTVAEQICERLRGKRLIKRE
TGRDIGALTLSGGLAQARPGEAQGALIERADAALYAAKGQGRDRICLA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccgacatccgcccaacgcgtgtccacccgcgcgtccaccccacagcaggatgggctc
tggtcctaccttcaggccctcgtggccacgacactcgacaccattcgcgagcacggcctc
cacccgagccctgccgggttcgaactgctgttccgccatcacagccgcgcgctcccggac
gcggatctcgggccgctcttggcgcgtgttcgatccctggcacagcacgggagctccccg
cctctgccggagatcgatctcgacgcggtgcatgacggggccgaggtcctggagagcgag
gcgggccggctcgccgcggccctgtccggcagcgcgcaggccctggccacctacggctcg
gtcctgagtgcctgcaacgatcgcctcggcgccgctccctcggccgcgatgctgatgcag
tccgtggccctgctcacccgcgagaccgcccgcgtcagcgcccgcaacgccgagctggaa
ggcgagctgcgtcaggcaggcgagcggatcggcaagctgcagcgcaacctcgccagcgtg
cgccaggaggcgagcgtcgacgccctgaccgggatcgccaaccggcgcgccttcaccgcg
cgcctgcgtcgccagcttgcccaggccaaggcggagggcgccggcccgttctgcctcgtc
ctgttggacgtggaccacttcaagctgttcaacgacgcgcacggccaccgcacgggcgat
caggtcctgcggctggtggcgcgcctgctcaccgacaatgtgaaggggcgcgacttcgtg
gcccgctacggcggcgaggagttcgcgctgatcctgagcgacgtggatgccgagagcggg
ctgacggtggccgagcagatctgcgagcggctgcgcggcaagcggctgatcaagcgcgag
acggggcgggacatcggcgcgctgacgctgtcgggcgggctggcgcaagcccggccgggc
gaggcgcagggcgcgctcatcgagcgggccgacgcggccctgtacgcggccaagggccag
ggccgggatcgcatctgcctcgcctga

DBGET integrated database retrieval system