KEGG   Methylobacterium sp. 4-46: M446_2861Help
Entry
M446_2861         CDS       T00679                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
met  Methylobacterium sp. 4-46
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    M446_2861
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     M446_2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3175855..3177792)
Genome map
AA seq 645 aa AA seqDB search
MSETSEHARLNRRQLLGTTAAAAATGAVAGAAGTRGLATPAEAQTKPSARPALAGGPNKT
EVKPGDLDEYYVFFSSGQTGELRIVGLPSMRELMRVPVFNRDSATGWGLTDQSRKVLTEG
LLPETKQFLETRGGVYHNGDLHHPHLSFTDGTYDGRYCFVNDKANTRVARIRLDVMRCDK
IIELPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLPNDGKVLDDNKQYHAIFTAVDGDTMQ
VAWQVLVDGNLDNVDADYQGKYAFATCYNSEEGVTLAEMTANEQDWVVIFNIKRIEEAVR
KGEAKVVGGVPMVDGRHGSRFTRYVPVSNSPHGMNTAPDGIHVVANGKLSPTVTVMDVRL
FDDLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNAFTTLFIDSQVVKWNIEKARQAYKG
AKVDPILQKLDVHYQPGHNHSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQLID
ISGDKMMIVHDGPSFAEPHDATIVHRSKINPISIWDRADPFFADQVKQANADGVRLEEDN
KVIRDGDKVRVYMTSTAPSFGLESFTVKQGDQVTVHVTNIDAVEDLTHGFSIVNYGIQME
VAPQATASVTFTANKPGVYWYYCSWFCHAMHMEMKGRMFVEPKNV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacttccgagcacgccaggctgaatcgcagacagctgctgggcaccacggcc
gccgcggcggcgaccggcgccgtcgcgggggcggccggaacgcgcggtctcgcgacgccg
gccgaggcgcagacgaagccgagcgcgcgccccgcgctcgccggcggcccgaacaagacc
gaggtcaagcccggcgatctcgacgagtactacgtcttcttctcgagcggacagaccggc
gagctccgcatcgtcgggttgccgtcgatgcgcgagctgatgcgggttccggtgttcaac
cgcgacagcgccacgggctggggcctcaccgaccagagccgcaaggtgctgaccgagggc
ctccttcccgagacgaagcagtttctggagactcgcggcggcgtctatcacaacggcgac
ctgcaccacccgcacctgtcgttcacggacggcacctatgacgggcgctactgtttcgtg
aatgacaaggccaacacgcgcgtggcccgcatccgcctcgacgtgatgcggtgcgacaag
atcatcgagctgcccaaccagcataccgttcatggcctgcgtgtgcagaagtatccccgc
accggctacgtcttctgcaacggcgaggaccgggtgccgcttccgaacgacggcaaggtg
ctcgacgacaacaagcagtatcacgccattttcactgccgtggacggcgacacgatgcag
gtcgcctggcaggtgctggtggacggcaacctcgacaacgtcgatgcggactatcagggc
aaatacgccttcgcgacctgctacaattccgaagaaggggtcacgctggccgagatgacc
gccaacgagcaggattgggtggtcatcttcaacatcaagcgcatcgaggaggcggtgcgc
aagggtgaggccaaggtggtcggtggcgtaccgatggtcgacggccggcatggctcgcgc
ttcacccgctacgtcccggtttcgaacagcccgcacggcatgaacaccgcaccggacggc
atccacgtcgtcgccaacggcaagctgtcgccgaccgtgacggtgatggatgtccgtctc
ttcgatgatctgtttgacgacaagatcaagccgcgcgacgtcgtggtcgccgagccggag
ctcggcctcggtccgttgcacacggcctatgatggcaagggcaatgccttcacgaccctg
ttcatcgacagtcaagtggtgaagtggaacatcgagaaggcccggcaggcctacaagggc
gccaaggtcgacccgatcctccagaagctcgacgtccattatcagccgggccacaaccac
agctccatgggacagacgaaggaggcggatggcaagtggctcatctcgctcaataagttc
tcgaaggaccgttttctgaacgttggaccactgaagccggaaaacgaccagctgatcgac
atctcgggtgacaagatgatgatcgtgcatgacggcccgagctttgccgagccgcatgac
gcgaccatcgtccatcgctccaagatcaacccgatctcgatctgggaccgggccgatccc
ttcttcgctgaccaagtaaagcaggccaacgccgatggcgtcaggcttgaggaggacaac
aaggtcatccgcgacggtgacaaggttcgcgtctacatgacctcgacggccccgtccttc
ggtctcgagagcttcacggtgaagcagggcgaccaggtcaccgtccacgtcaccaatatc
gacgcggtcgaggatctcacgcacggcttctcgatcgtgaactacggcattcagatggaa
gtcgcgccgcaggcgacggcctcggtgaccttcacggccaataagccaggcgtctactgg
tactactgctcttggttctgccatgcgatgcacatggagatgaaagggcggatgttcgtg
gagcccaagaacgtctga

DBGET integrated database retrieval system