KEGG   Methylobacterium sp. 4-46: M446_2952Help
Entry
M446_2952         CDS       T00679                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00010  Glycolysis / Gluconeogenesis
met00620  Pyruvate metabolism
met00640  Propanoate metabolism
met00680  Methane metabolism
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M446_2952
   00620 Pyruvate metabolism
    M446_2952
   00640 Propanoate metabolism
    M446_2952
  Energy metabolism
   00680 Methane metabolism
    M446_2952
Enzymes [BR:met01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M446_2952
Lipid biosynthesis proteins [BR:met01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M446_2952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACA17364
JGI: M4462952
UniProt: B0UJV0
Position
3272386..3274335
Genome map
AA seq 649 aa AA seqDB search
MTQRIVAVPAAVKERAYIDEAKYRAWYEASINDPEGFWREHGKRIDWFKPYTKVKETDFG
PGNVSIRWFADGVTNVAHNCIDRHLATRGDQVAIIWEGDDPSESRSITYRELHAEVCRMA
NVLRNRGVGKGDRVTIYLPMIPEAAFAMLACARLGAIHSIVFGGFSPDSLAGRIEGCASK
LVITADEGLRGGRKVPLKANVDAAIQRLPRDSVDHVIVVRRTGGSVAMEAGRDVYYDDAA
REVTDECPVEHVEAEHPLFLLYTSGSTGQPKGVVHTTGGYLVYASMTHQYVFDYHEGEVY
WCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSVSRFWDVVDKHKVNIFYTAPTAI
RSLMGAGEEPVKKASRSTLRVLGSVGEPINPEAWEWYYRVVGDERCPIVDTWWQTETGGI
LISPLPGATALKPGSATQPFFGVKPVVVDGDNKVLEGACEGNLCLADSWPGQMRTVWGDH
ERFVQTYFSTFPGRYFSGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESSLVAHPK
VSEAAVVGYPHSLKGQGIYAYVTLMNGEEPTEALRKELVAWVRKDIGPIASPDLIQFAPG
LPKTRSGKIMRRILRKIAEDDFSSLGDTSTLADPGVVDDLIENRQNRAG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacggatcgtcgcggtgccggccgccgtcaaggagcgggcatatatcgatgag
gccaagtatcgcgcttggtatgaggcttcgattaacgatcccgaaggattctggcgcgag
cacggcaagcggatcgactggttcaagccctacaccaaggtgaaggagaccgatttcggt
ccgggcaacgtctcgatccgctggttcgcggacggcgtcaccaacgtcgcgcacaattgc
atcgaccgccacctggccacgcgcggtgatcaggtcgcgatcatctgggagggcgacgat
ccctccgagtcccgcagcatcacctaccgcgaactgcacgcggaggtctgccggatggcg
aacgtcctgcgcaaccgcggcgtcggcaagggcgaccgggtcaccatctacttgccgatg
attcccgaggcggccttcgccatgctggcctgcgcgcggctcggcgccatccactcgatc
gtcttcggcggcttctcgcccgattcgctcgccggccgcatcgagggctgcgcctccaag
ctggtgatcaccgcggacgagggcctgcgcggcggccgcaaggtgccgctcaaggccaat
gtcgacgcggcgatccagcgcctgccgcgggacagcgtcgaccacgtcatcgtggtgcgc
cgcaccggcggcagcgtcgccatggaggcggggcgcgacgtctactacgacgacgccgcc
cgcgaggtcaccgacgagtgcccggtggagcacgtcgaggccgagcacccgctcttcctg
ctctacacgtcgggctcgaccggccagccgaagggcgtcgtccacaccaccggcggctac
ctcgtctacgcctcgatgacgcaccaatacgtcttcgactatcacgagggcgaggtctac
tggtgcacggccgatgtcggctgggtgacgggccattcctacatcgtgtacgggccgctc
gcgaacggcgccacgaccctgatgttcgagggcatcccgacctacccctcggtctcccgg
ttctgggacgtggtcgacaagcacaaggtcaacatcttctacaccgccccgaccgccatc
cgctccctgatgggcgcgggcgaggagccggtgaagaaggcctcgcggtcgacgctgcgc
gtcctcggctcggtcggcgagccgatcaaccccgaggcctgggaatggtactaccgggtc
gtcggcgacgagcgctgcccgatcgtcgacacgtggtggcagaccgagaccggcggcatc
ctgatctcgccgctgcccggggccaccgccctcaagcccggctcggccacccagcccttc
ttcggcgtcaagccggtggtggtggacggcgacaacaaggtgctggagggcgcctgcgag
ggcaacctctgcctcgccgattcctggccgggccagatgcgcaccgtctggggcgaccac
gagcgcttcgtgcagacctacttctcgaccttcccgggccgctacttctcgggcgacggc
tgccgccgcgacgaggacggctactactggatcacgggccgggtcgacgacgtcatcaac
gtctcgggccaccgcatgggcacggccgaggtggaatcctcgctggtggcgcatccgaaa
gtctcggaagccgcggtggtgggctatccccacagcctcaagggccagggcatctacgcc
tacgtcaccctgatgaacggcgaggagccgaccgaggcgctgcgcaaggaactggtcgcc
tgggtgcgcaaggatatcgggccgatcgcctcgccggacctgatccagttcgcccccggc
ctgcccaagacccgctcgggcaagatcatgcggcgcatcctgcgcaagatcgccgaggac
gacttctcctcgctgggtgacacctcgaccctcgccgatcccggcgtggtcgacgacctg
atcgagaaccggcagaaccgcgccggctga

DBGET integrated database retrieval system