KEGG   Methylobacterium sp. 4-46: M446_3032Help
Entry
M446_3032         CDS       T00679                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
met  Methylobacterium sp. 4-46
Pathway
met01100  Metabolic pathways
met01120  Microbial metabolism in diverse environments
met02020  Two-component system
Brite
KEGG Orthology (KO) [BR:met00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M446_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ACA17443
JGI: M4463032
UniProt: B0ULC2
Position
complement(3357327..3357683)
Genome map
AA seq 118 aa AA seqDB search
MRQFILGAALALLAPLTAQAQDAAAGEKLFSQCKACHAFGKNGVGPDLKGVVGRKAGTHE
GYSYSAALKDSGLTWDEATLHKWLANPKGLVSGTKMIYAGLKEDKKIDDLVAYLKTQQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagttcatcctcggtgccgccctcgcgctgctcgcccccctgacggcgcaggcg
caggacgccgccgccggcgagaagctgttctcgcagtgcaaggcctgccacgctttcggc
aagaacggcgtcggccccgacctgaagggcgtcgtcgggcgcaaggccggcacccacgag
ggctacagctactccgccgcgctcaaggattcgggcctgacctgggacgaggccaccctg
cacaagtggctcgccaacccgaagggcctggtctccggcaccaagatgatctacgccgga
ctcaaggaagacaagaagatcgacgacctcgtcgcctacttgaagacccagcagtaa

DBGET integrated database retrieval system