KEGG   Methylobacterium sp. 4-46: M446_3281Help
Entry
M446_3281         CDS       T00679                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00071  Fatty acid degradation
met00280  Valine, leucine and isoleucine degradation
met00281  Geraniol degradation
met00310  Lysine degradation
met00362  Benzoate degradation
met00380  Tryptophan metabolism
met00410  beta-Alanine metabolism
met00640  Propanoate metabolism
met00650  Butanoate metabolism
met00903  Limonene and pinene degradation
met00930  Caprolactam degradation
met01040  Biosynthesis of unsaturated fatty acids
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01200  Carbon metabolism
met01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M446_3281
   00650 Butanoate metabolism
    M446_3281
  Lipid metabolism
   00071 Fatty acid degradation
    M446_3281
   01040 Biosynthesis of unsaturated fatty acids
    M446_3281
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M446_3281
   00310 Lysine degradation
    M446_3281
   00380 Tryptophan metabolism
    M446_3281
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M446_3281
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M446_3281
   00281 Geraniol degradation
    M446_3281
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M446_3281
   00930 Caprolactam degradation
    M446_3281
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     M446_3281
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M446_3281
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     M446_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N DAO NAD_binding_8 FAD_binding_3 F420_oxidored 2-Hacid_dh_C ApbA Pyr_redox_2 NAD_binding_7 DFP Sacchrp_dh_NADP NAD_Gly3P_dh_N AlaDh_PNT_C GFO_IDH_MocA GIDA
Motif
Other DBs
NCBI-ProteinID: ACA17686
JGI: M4463281
UniProt: B0UQK0
Position
3636228..3638429
Genome map
AA seq 733 aa AA seqDB search
MDLTHFRFETDQDGIALATWDSPGRSMNVITPEVMAELDRIIDAVAGDAAVKGCVITSGK
EAFSGGADLTMLQGLGAEYARLSRERGEEEAMRFFFEETRRLSLLYRKLETCGKPFAAAI
HGTCLGGAFELALACHHRVVSDDDKTRVGLPEIKVGLFPGAGGTQRVARLMQTGDALQML
FKGDQIRPLMARNMGLVHAVAKRDSVVAEAKAWIRGGGAALAPWDQPKFKAPSGKVYSPA
GMMTWPPANAIYRRETHDNYPAAKAILQSVYEGLQLPMDLALKVESRYFAKILRSPEAAA
MIRSLFVSMGELNKGARRPAAIGPVSLKRVGVVGAGFMGAGIAYVTAQAGIEVVLIDQSA
EAAEKGKAYSHKLVSDQIMKGRAKTADRDALLARITATADYAALSDCDLVIEAVFEDPKV
KAEVIAKVEASIRPETIFASNTSTLPISGLADGSARPDQFIGIHFFSPVEKMLLVEIIKG
RQSGERALAAALDYVRAIRKTPIVVNDARGFFANRCVGAYILEGHLMLAEGVPAAMIENA
GRQAGMPVGPLSLNDEVGVDLGLKILKATKAQAGEGAVNPLQERLLVALVEGEGRLGRKN
RKGFYDYPENGPKRLWPGLAALAGTRQDPDAVDFQELKHRLLVAQAVEAARVYGEGVVTD
PREADVGSILGFGFAPFTGGVLSYIDGMGARRFVELCRRLEAKHGARFAPPANLLAMAET
GERFYGRAEARAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacctcacgcatttccgcttcgagaccgatcaagacggcatcgcgctcgcgacctgg
gacagccccggccgctccatgaacgtgatcacccccgaggtgatggccgaactcgaccgg
atcatcgacgcggtcgcgggcgacgccgccgtcaagggctgcgtcatcacctcgggcaag
gaggccttctcgggcggggccgacctcacgatgctgcaggggctgggcgccgaatacgcc
cggctcagccgggagcgcggcgaggaggaggcgatgcgcttcttcttcgaggagacccgc
cgcctctcgctgctctaccggaagctcgagacctgcgggaagcccttcgcggcggcgatc
cacggcacctgcctgggcggcgccttcgagctcgcgctcgcctgccatcaccgcgtcgtc
tcggacgacgacaagacccgggtcggcctgccggagatcaaggtcgggctgttccccggg
gccggcggcactcagcgcgtcgcccgcctgatgcagaccggcgacgccctgcagatgctg
ttcaagggcgaccagatccggccgctcatggcccgcaacatgggcctcgtccacgcggtg
gccaagcgcgattccgtcgtcgcggaggccaaggcctggatccggggcggcggcgcggcg
ctcgccccctgggaccagccgaagttcaaggccccctccggcaaggtctactcgccggcc
gggatgatgacctggccgcccgccaacgccatctaccgccgcgagacccacgacaattac
ccggccgcgaaggcgatcctgcaatcggtctacgagggcctgcagctgccgatggacctc
gcgctcaaggtcgagagccgctacttcgccaagatcctgcgctcgccggaagccgcggcg
atgatccgctcgctcttcgtctcgatgggcgagctcaacaagggcgcccggcgcccggcc
gcgatcggcccggtcagcctcaagcgggtcggggtcgtcggcgcgggcttcatgggcgcg
ggcatcgcctacgtgacggcgcaggccgggatcgaggtcgtgctgatcgaccagagcgcg
gaggcggccgagaagggcaaggcctactcgcacaagctcgtctccgaccagatcatgaag
ggccgcgccaagaccgccgaccgcgacgcgctgctcgcccgcatcaccgccaccgccgac
tacgccgccctgtccgactgcgacctcgtgatcgaggcggtgttcgaggacccgaaggtc
aaggccgaggtcatcgccaaggtcgaggcgtcgatccgccccgagacgatcttcgcctcc
aacacctcgacgctgccgatcagcggcctcgccgacggctccgcccggcccgaccagttc
atcggcatccacttcttctcgccggtcgagaagatgctgctggtcgagatcatcaagggg
cggcagagcggcgagcgggcgctcgccgccgccctcgactacgtgcgggcgatccgcaag
acgccgatcgtggtcaacgacgcgcgcggcttcttcgccaaccgctgcgtgggcgcctac
atcctcgaaggccacctgatgctcgccgagggggtgccggccgccatgatcgagaatgcc
gggcggcaggccggcatgccggtcggtcccctctccctcaatgacgaggtcggcgtcgat
ctcggcctcaagatcctgaaggccaccaaggcccaggccggcgagggcgccgtgaacccg
ctccaggagcgcctgctcgtcgccctcgtcgagggcgagggacggctcgggcgcaagaac
cgcaagggcttctacgattacccggagaacgggccgaagcggctctggccgggcctcgcg
gcgctcgccgggacgcgccaggatcccgacgcggtcgacttccaggaactgaagcaccgg
ctcctcgtcgcccaggcggtcgaggcggcccgggtctacggcgagggcgtggtgacggat
ccccgcgaggcggatgtcggctcgatcctcggcttcggcttcgcgcccttcacgggcggg
gtgctctcctacatcgacggcatgggcgcccgccgcttcgtggagctgtgccgccgcctc
gaggccaagcacggcgcccgcttcgcgcccccggcgaacctgctcgccatggcggagacg
ggcgagcgcttctacggccgcgcggaggcccgggcggcctga

DBGET integrated database retrieval system